1. Recombinant Proteins
  2. Others
  3. SLITRK6 Protein, Human (HEK293, His)

The SLITRK6 protein is a key regulator that coordinates neurite growth, which is critical for normal hearing and vision, affecting neuronal development and intercellular communication. Its importance in sensory function emphasizes its important role in the molecular mechanisms of sensory perception. SLITRK6 Protein, Human (HEK293, His) is the recombinant human-derived SLITRK6 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SLITRK6 protein is a key regulator that coordinates neurite growth, which is critical for normal hearing and vision, affecting neuronal development and intercellular communication. Its importance in sensory function emphasizes its important role in the molecular mechanisms of sensory perception. SLITRK6 Protein, Human (HEK293, His) is the recombinant human-derived SLITRK6 protein, expressed by HEK293 , with C-His labeled tag.

Background

SLITRK6 emerges as a key regulator in the intricate orchestration of neurite outgrowth, playing a crucial role in maintaining normal hearing and vision. This protein's influence extends to the intricate processes involved in neuronal development, particularly in the growth of neurites, which are essential structures for intercellular communication. The significance of SLITRK6 in sensory functions, such as hearing and vision, emphasizes its importance in the intricate network of molecular mechanisms that underlie sensory perception. As a regulator of neurite outgrowth, SLITRK6 contributes to the establishment and maintenance of neuronal connections critical for proper sensory processing, shedding light on its vital role in neural development and sensory function.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human SLITRK6 at 10 μg/mL (100 μL/well) can bind Sirtratumab (HY-P99964). The ED50 for this effect is 19.86 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human SLITRK6 at 10 μg/mL (100 μL/well) can bind Sirtratumab (HY-P99964). The ED50 for this effect is 19.86 ng/mL.
Species

Human

Source

HEK293

Tag

C-10*His

Accession

Q9H5Y7 (S27-S608)

Gene ID
Molecular Construction
N-term
SLITRK6 (S27-S608)
Accession # Q9H5Y7
10*His
C-term
Protein Length

Extracellular Domain

Synonyms
SLIT and NTRK-like protein 6; SLITRK6
AA Sequence

SRGSCDSLCNCEEKDGTMLINCEAKGIKMVSEISVPPSRPFQLSLLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIEIGAFNGLGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKWACNCDLLQLKTWLENMPPQSIIGDVVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPSGSLHLAATSSINDSRMSTKTTSILKLPTKAPGLIPYITKPSTQLPGPYCPIPCNCKVLSPSGLLIHCQERNIESLSDLRPPPQNPRKLILAGNIIHSLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLTKLSKGMFLGLHNLEYLYLEYNAIKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFSGVPLTKVNLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTVTDDILCTSPGHLDKKELKALNSEILCPGLVNNPSMPTQTSYLMVTTPATTTNTADTILRSLTDAVPLS

Molecular Weight

Approximately 89 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 10% glycerol, 0.01% Tween 20, pH8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SLITRK6 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SLITRK6 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SLITRK6 Protein, Human (HEK293, His)
Cat. No.:
HY-P77208
Quantity:
MCE Japan Authorized Agent: