Copy Link Print Information

SLITRK6 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The SLITRK6 protein is a key regulator that coordinates neurite growth, which is critical for normal hearing and vision, affecting neuronal development and intercellular communication. Its importance in sensory function emphasizes its important role in the molecular mechanisms of sensory perception. SLITRK6 Protein, Human (HEK293, His) is the recombinant human-derived SLITRK6 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for SLITRK6 Protein, Human (HEK293, His)
  • Experimental Validation Results for SLITRK6 Protein, Human (HEK293, His)
  • SLITRK6 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The SLITRK6 protein is a key regulator that coordinates neurite growth, which is critical for normal hearing and vision, affecting neuronal development and intercellular communication. Its importance in sensory function emphasizes its important role in the molecular mechanisms of sensory perception. SLITRK6 Protein, Human (HEK293, His) is the recombinant human-derived SLITRK6 protein, expressed by HEK293 , with C-His labeled tag.

Background

SLITRK6 emerges as a key regulator in the intricate orchestration of neurite outgrowth, playing a crucial role in maintaining normal hearing and vision. This protein's influence extends to the intricate processes involved in neuronal development, particularly in the growth of neurites, which are essential structures for intercellular communication. The significance of SLITRK6 in sensory functions, such as hearing and vision, emphasizes its importance in the intricate network of molecular mechanisms that underlie sensory perception. As a regulator of neurite outgrowth, SLITRK6 contributes to the establishment and maintenance of neuronal connections critical for proper sensory processing, shedding light on its vital role in neural development and sensory function.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human SLITRK6 at 10 μg/mL (100 μL/well) can bind Sirtratumab (HY-P99964). The ED50 for this effect is 19.86 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human SLITRK6 at 10 μg/mL (100 μL/well) can bind Sirtratumab (HY-P99964). The ED50 for this effect is 19.86 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession

    Q9H5Y7 (S27-S608)

  • Gene ID
    84189  [NCBI]
  • Molecular Construction
    • N-term
    • SLITRK6 (S27-S608)
      Accession # Q9H5Y7
    • 10*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SLITRK6; SLIT And NTRK-Like Family, Member 6; SLIT And NTRK Like Family Member 6; Slit And Trk Like Gene 6; SLIT And NTRK-Like Protein 6; 4832410J21Rik; FLJ22774; DFNMYP

  • AA Sequence

    SRGSCDSLCNCEEKDGTMLINCEAKGIKMVSEISVPPSRPFQLSLLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIEIGAFNGLGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKWACNCDLLQLKTWLENMPPQSIIGDVVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPSGSLHLAATSSINDSRMSTKTTSILKLPTKAPGLIPYITKPSTQLPGPYCPIPCNCKVLSPSGLLIHCQERNIESLSDLRPPPQNPRKLILAGNIIHSLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLTKLSKGMFLGLHNLEYLYLEYNAIKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFSGVPLTKVNLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTVTDDILCTSPGHLDKKELKALNSEILCPGLVNNPSMPTQTSYLMVTTPATTTNTADTILRSLTDAVPLS

  • Molecular Weight

    Approximately 89 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 10% glycerol, 0.01% Tween 20, pH8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Human SLITRK6 at 10 μg/mL (100 μL/well) can bind Sirtratumab (HY-P99964). The ED50 for this effect is 19.86 ng/mL.

  • SLITRK6 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for SLITRK6 Protein, Human (HEK293, His)
  • Experimental Validation Results for SLITRK6 Protein, Human (HEK293, His)
  • SLITRK6 Protein, Human (HEK293, His) Product Image