SLITRK6 Protein, Human (HEK293, His)

The SLITRK6 protein is a key regulator that coordinates neurite growth, which is critical for normal hearing and vision, affecting neuronal development and intercellular communication. Its importance in sensory function emphasizes its important role in the molecular mechanisms of sensory perception. SLITRK6 Protein, Human (HEK293, His) is the recombinant human-derived SLITRK6 protein, expressed by HEK293 , with C-His labeled tag.

SLITRK6 emerges as a key regulator in the intricate orchestration of neurite outgrowth, playing a crucial role in maintaining normal hearing and vision. This protein's influence extends to the intricate processes involved in neuronal development, particularly in the growth of neurites, which are essential structures for intercellular communication. The significance of SLITRK6 in sensory functions, such as hearing and vision, emphasizes its importance in the intricate network of molecular mechanisms that underlie sensory perception. As a regulator of neurite outgrowth, SLITRK6 contributes to the establishment and maintenance of neuronal connections critical for proper sensory processing, shedding light on its vital role in neural development and sensory function.

Measured by its binding ability in a functional ELISA. Immobilized Human SLITRK6 at 10 μg/mL (100 μL/well) can bind Sirtratumab (HY-P99964). The ED₅₀ for this effect is 19.86 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human SLITRK6 at 10 μg/mL (100 μL/well) can bind Sirtratumab (HY-P99964). The ED₅₀ for this effect is 19.86 ng/mL.

Human

HEK293

C-10*His

Q9H5Y7 (S27-S608)

84189  [NCBI]

Extracellular Domain

SRGSCDSLCNCEEKDGTMLINCEAKGIKMVSEISVPPSRPFQLSLLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIEIGAFNGLGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKWACNCDLLQLKTWLENMPPQSIIGDVVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPSGSLHLAATSSINDSRMSTKTTSILKLPTKAPGLIPYITKPSTQLPGPYCPIPCNCKVLSPSGLLIHCQERNIESLSDLRPPPQNPRKLILAGNIIHSLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLTKLSKGMFLGLHNLEYLYLEYNAIKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFSGVPLTKVNLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTVTDDILCTSPGHLDKKELKALNSEILCPGLVNNPSMPTQTSYLMVTTPATTTNTADTILRSLTDAVPLS

Approximately 85-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 10% glycerol, 0.01% Tween 20, pH8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.