Copy Link Print Information

SMPDL3A Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

SMPDL3A protein hydrolyzes nucleotide triphosphates, particularly ATP, and p-nitrophenyl-TMP. It has limited activity with nucleoside diphosphates and none with nucleoside monophosphates. SMPDL3A also catalyzes the conversion of CDP-choline to CMP and phosphocholine, and CDP-ethanolamine. However, it lacks sphingomyelin phosphodiesterase activity. SMPDL3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived SMPDL3A protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • SMPDL3A Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SMPDL3A protein hydrolyzes nucleotide triphosphates, particularly ATP, and p-nitrophenyl-TMP. It has limited activity with nucleoside diphosphates and none with nucleoside monophosphates. SMPDL3A also catalyzes the conversion of CDP-choline to CMP and phosphocholine, and CDP-ethanolamine. However, it lacks sphingomyelin phosphodiesterase activity. SMPDL3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived SMPDL3A protein, expressed by HEK293 , with C-His labeled tag.

Background

SMPDL3A protein demonstrates in vitro nucleotide phosphodiesterase activity, specifically with nucleoside triphosphates, including ATP. It also exhibits activity with p-nitrophenyl-TMP, but to a lesser extent with nucleoside diphosphates and lacks activity with nucleoside monophosphates. Additionally, SMPDL3A displays in vitro enzymatic activity with CDP-choline, yielding CMP and phosphocholine, and with CDP-ethanolamine. However, it does not possess sphingomyelin phosphodiesterase activity.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    P70158/NP_065586.3 (V23-L445)

  • Gene ID
    57319  [NCBI]
  • Molecular Construction
    • N-term
    • SMPDL3A (V23-L445)
      Accession # P70158/NP_065586.3
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SMPDL3A; 2',3'-CGAMP Phosphodiesterase SMPDL3A; Sphingomyelin Phosphodiesterase Acid Like 3A; ASM-Like Phosphodiesterase 3a; Acid Sphingomyelinase-Like Phosphodiesterase 3a; FLJ20177; YR36GH4.1; Sphingomyelin Phosphodiesterase Acid-Like 3A; ASML3a; 061001

  • AA Sequence

    VPLAPADRAPAVGQFWHVTDLHLDPTYHITDDRTKVCASSKGANASNPGPFGDVLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQNLFPNLQVFPALGNHDYWPQDQLPIVTSKVYSAVADLWKPWLGEEAISTLKKGGFYSQKVASNPGLRIISLNTNLYYGPNIMTLNKTDPANQFEWLENTLNSSLWNKEKVYIIAHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKNGNPLNSVFVAPAVTPVKGVLQKETNNPGVRLFQYKPGDYTLLDMVQYYLNLTEANLKGESNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQHCKTLQVCAIMNLDSMSYDDCLKQHL

  • Molecular Weight

    Approximately 55-75 kDa due to the glycosylation

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • SMPDL3A Protein, Mouse (HEK293, His) Product Image
    1/16
  • SMPDL3A Protein, Mouse (HEK293, His) Product Image