ST6GAL1 Protein, Mouse (HEK293, His)
Based on 1 publication(s) in Google Scholar
ST6GAL1 Protein catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing acceptor substrates.ST6GAL1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ST6GAL1 Protein catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing acceptor substrates.ST6GAL1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.
Background
ST6GAL1 protein functions as a catalyst in the transfer of sialic acid from CMP-sialic acid to galactose-containing acceptor substrates.
Verified Bioactivity
Measured by its ability to transfer Neu5Ac from CMP-Neu5Ac to N-Acetyllactosamine. The specific activity is > 150 pmol/min/μg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Crohns Colitis
ST6GAL1 promotes IBD B cell recruitment to the inflamed colon in a CD22-dependent mechanism. [Abstract]2025 Jul 3;19(7):jjaf097. PMID: 40491026
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-His
-
Accession
Q64685 (K27-C403)
-
Molecular Construction
-
N-term
-
His
-
ST6GAL1 (K27-C403)
Accession # Q64685 -
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
ST6GAL1; ST6GalI; Prev. SIAT1; Sialyltransferase 1 (Beta-Galactoside Alpha-2,6-Sialyltransferase); Beta-Galactoside Alpha-2,6-Sialyltransferase 1; Sialyltransferase 1 (Beta-Galactoside Alpha-2,6-Sialytransferase); CDw75; Beta-Galactoside Alpha-(2,6)-Sialy
-
AA Sequence
KKGSDYEALTLQAKVFQMPKSQEKVAVGPAPQAVFSNSKQDPKEGVQILSYPRVTAKVKPQPSLQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKAGPWHKCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGTKTTIRLVNSQLVTTEKRFLKDSLYTEGILILWDPSVYHADIPQWYQKPDYNFFETYKSYRRLHPSQPFYILKPQMPWELWDIIQEISPDLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNNRC
-
Predicted Molecular Mass
45.9 kDa
-
Molecular Weight
Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 120 mM NaCl, pH7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
