ST6GAL1 Protein, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to acceptor substrates that contain galactose. Sialic acid is a crucial component of various glycoproteins and glycolipids, and its transfer mediated by ST6GAL1 protein plays a vital role in modulating the structure and function of these molecules. By attaching sialic acid to galactose residues on acceptor substrates, ST6GAL1 protein influences cellular processes such as cell adhesion, signaling, and immune response. This enzymatic activity is essential for the proper functioning of numerous biological systems, and understanding the role of ST6GAL1 protein can have implications in various fields including immunology, cancer research, and glycoengineering.

Measured by its ability to transfer Neu5Ac from CMP-Neu5Ac to N-Acetyllactosamine that incubate at 37°C for 20min. The specific activity is 288.256 pmol/min/μg.

Rat

HEK293

N-6*His

P13721-1/NP_001106815.1 (K27-C403)

25197  [NCBI]

Lumenal Domain

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Approximately 47-57 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.