Stratifin Protein, Human
Based on 1 publication(s) in Google Scholar
Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human is the recombinant mouse-derived Stratifin protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human is the recombinant mouse-derived Stratifin protein, expressed by E. coli , with tag free.
Background
Stratifin, also known as 14-3-3 sigma, encoded by the SFN gene, is a multifunctional protein belonging to the 14-3-3 family. It serves as an adapter protein, engaging in diverse cellular processes by binding to numerous partners through the recognition of phosphoserine or phosphothreonine motifs. Its pivotal roles include regulation of epithelial cell growth and protein synthesis when bound to keratin 17 (KRT17), as well as potential involvement in MDM2 autoubiquitination and degradation, leading to the activation of the tumor suppressor p53. Existing as a homodimer and participating in various protein complexes, stratifin interacts with a wide array of proteins, such as GAB2, SAMSN1, SRPK2, COPS6, COP1, DAPK2, PI4KB, SLITRK1, and LRRK2, showcasing its versatility in orchestrating crucial cellular processes and signaling pathways.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Brain Res
Sulforaphane attenuates microglia-mediated neuronal damage by down-regulating the ROS/autophagy/NLRP3 signal axis in fibrillar Aβ-activated microglia. [Abstract]2023 Feb 15:1801:148206. PMID: 36539049
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P31947-1 (M1-S248)
-
Molecular Construction
-
N-term
-
Stratifin (M1-S248)
Accession # P31947-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
SFN; 14-3-3 Protein Sigma; Stratifin; 14-3-3 Sigma; YWHAS; HME1; Epithelial Cell Marker Protein 1
-
AA Sequence
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
-
Predicted Molecular Mass
27.8 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 250 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)