TAFA1/FAM19A1 Protein, Human
Based on 1 Customer Validation
The Dll3 protein is a transmembrane ligand that plays a critical role in regulating cell differentiation and patterning during embryonic development. It participates in the Notch signaling pathway and helps determine cell fate. TAFA1/FAM19A1 Protein, Human is the recombinant human-derived TAFA1/FAM19A1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Dll3 protein is a transmembrane ligand that plays a critical role in regulating cell differentiation and patterning during embryonic development. It participates in the Notch signaling pathway and helps determine cell fate. TAFA1/FAM19A1 Protein, Human is the recombinant human-derived TAFA1/FAM19A1 protein, expressed by E. coli , with tag free.
Background
The TAFA1/FAM19A1 protein belongs to the TAFA family, which consists of five closely related genes encoding small secreted proteins. These proteins share conserved cysteine residues at specific positions and are distantly related to MIP-1alpha, a member of the CC-chemokine family. Primarily expressed in distinct brain regions, the TAFA proteins are believed to act as brain-specific chemokines or neurokines that regulate immune and nervous cells. This information is provided by RefSeq in July 2008. Notably, the TAFA1/FAM19A1 gene exhibits biased expression in the brain (RPKM 6.6) and prostate (RPKM 0.3).
Verified Bioactivity
1.Measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons. Human TAFA1/FAM19A1, immobilized at 6-24 μg/mL on a 96-well plate, is able to significantly enhance neurite outgrowth.
2.Measured by its ability to enhance the outgrowth of SH-SY5Y cells. The ED50 for this effect is 2.756 μg/mL, corresponding to a specific activity is 362.845 units/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q7Z5A9/NP_998774 (S26-T133)
-
Molecular Construction
-
N-term
-
TAFA1 (S26-T133)
Accession # Q7Z5A9/NP_998774 -
C-term
-
-
Protein Length
Partial
-
Synonyms
TAFA1; Family With Sequence Similarity 19 Member A1, C-C Motif Chemokine Like; Prev. FAM19A1; Family With Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A1; TAFA-1; Protein FAM19A1; TAFA Chemokine Like Family Member 1; Chemokine-Like Protein
-
AA Sequence
SLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT
-
Predicted Molecular Mass
12.1 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
