TCblR/CD320 Protein, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs). As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

TCblR/CD320 Protein, serving as the receptor for transcobalamin saturated with cobalamin (TCbl), assumes a pivotal role in cobalamin uptake. Positioned on the plasma membrane, it is notably expressed on follicular dendritic cells (FDC), facilitating interactions with germinal center B cells. Functioning as a costimulator, TCblR promotes B cell responses to antigenic stimuli, thereby fostering B cell differentiation and proliferation. Particularly influential in the differentiation of germinal center-B (GC-B) cells into memory B-cells and plasma cells (PC), TCblR engages in collaborative interactions with T-cells and follicular dendritic cells (FDC). Its involvement extends to augmenting the proliferation of PC precursors generated by IL-10. The interaction of CD320 with TCN2, mediated through its LDL-receptor class A domains, underscores its significance in cobalamin homeostasis and cellular processes.

Measured by its binding ability in a functional ELISA. Immobilized mouse CD320-His at 10 μg/mL (100 μl/well) can bind biotinylated mouse TCN2-His , The EC₅₀ of biotinylated mouse TCN2-His is 0.10-0.24 μg/mL.

Mouse

HEK293

C-His

Q9Z1P5-1 (M1-G208)

54219  [NCBI]

Partial

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Approximately 45-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.