Copy Link Print Information

TFF3 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Trefoil factor 3 (TFF3) is a small peptide (59 amino acids; 7 kDa) that is a member of the trefoil family and a stable secretory protein expressed in gastrointestinal mucosa, playing a role in restitution and regeneration of epithelia. The mode of action of Tff3 ranges from a simple increase in mucous viscosity, cytoprotection, and antiapoptotic and chemotactic effects to more complex immune regulatory functions, and has a strong association with tumorigenesis. TFF3 Protein, Human (HEK293, His) is the recombinant human-derived TFF3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TFF3 Protein, Human (HEK293, His)
  • Experimental Validation Results for TFF3 Protein, Human (HEK293, His)
  • TFF3 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Trefoil factor 3 (TFF3) is a small peptide (59 amino acids; 7 kDa) that is a member of the trefoil family and a stable secretory protein expressed in gastrointestinal mucosa, playing a role in restitution and regeneration of epithelia. The mode of action of Tff3 ranges from a simple increase in mucous viscosity, cytoprotection, and antiapoptotic and chemotactic effects to more complex immune regulatory functions, and has a strong association with tumorigenesis. TFF3 Protein, Human (HEK293, His) is the recombinant human-derived TFF3 protein, expressed by HEK293 , with C-His labeled tag.

Background

Trefoil factor 3 (TFF3) is a small peptide (59 amino acids; 7 kDa) that is a member of the trefoil family which are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides with three-loop structure. TFF3 is a stable secretory protein expressed in gastrointestinal mucosa, playing a role in restitution (cell migration to heal superficial lesions) and regeneration (differentiation and proliferation as repair) of epithelia, being involved in the maintenance and repair of the intestinal mucosa and promotes the mobility of epithelial cells in healing processes. The mode of action of Tff3 ranges from a simple increase in mucous viscosity, cytoprotection, and antiapoptotic and chemotactic effects to more complex immune regulatory functions. Tff expression patterns are altered in various tumors, implying a strong association with tumorigenesis. Tff3 presents in the bloodstream and various other organs, including the liver, brain, pancreas, and lymphoid tissue[1][2][3].

Verified Bioactivity

Measured by its ability to induce ERK1/ERK2 phosphorylation in Jurkat human acute T cell leukemia cells. 5-15 μg/mL of Recombinant Human TFF3 can effectively induce ERK1/2 phosphorylation.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce ERK1/ERK2 phosphorylation in Jurkat human acute T cell leukemia cells. 5-15 μg/mL of Recombinant Human TFF3 can effectively induce ERK1/2 phosphorylation.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q07654 (E22-F80)

  • Gene ID
    7033  [NCBI]
  • Molecular Construction
    • N-term
    • TFF3 (E36-F94)
      Accession # NP_003217.3
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    TFF3; Polypeptide P1.B; Trefoil Factor 3; TFI; ITF; Intestinal Trefoil Factor; HITF; HP1.B; Trefoil Factor 3 (Intestinal); P1B

  • AA Sequence

    EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

  • Predicted Molecular Mass

    8 kDa

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce ERK1/ERK2 phosphorylation in Jurkat human acute T cell leukemia cells. 5-15 μg/mL of Recombinant Human TFF3 can effectively induce ERK1/2 phosphorylation.

  • TFF3 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for TFF3 Protein, Human (HEK293, His)
  • Experimental Validation Results for TFF3 Protein, Human (HEK293, His)
  • TFF3 Protein, Human (HEK293, His) Product Image