TFPI2 Protein, Human (HEK293, C-His)
Based on 1 publication(s) in Google Scholar
The critical role of the TFPI2 protein in regulating plasmin-mediated matrix remodeling suggests its involvement in extracellular matrix dynamics. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weak factor Xa, affecting coagulation and fibrinolysis. TFPI2 Protein, Human (HEK293, C-His) is the recombinant human-derived TFPI2 protein, expressed by HEK293 , with C-10*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The critical role of the TFPI2 protein in regulating plasmin-mediated matrix remodeling suggests its involvement in extracellular matrix dynamics. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weak factor Xa, affecting coagulation and fibrinolysis. TFPI2 Protein, Human (HEK293, C-His) is the recombinant human-derived TFPI2 protein, expressed by HEK293 , with C-10*His labeled tag.
Background
The TFPI2 protein may have a crucial role in the regulation of plasmin-mediated matrix remodeling, suggesting its involvement in the intricate processes that govern extracellular matrix dynamics. TFPI2 exhibits inhibitory effects on trypsin, plasmin, factor VIIa/tissue factor, and weakly on factor Xa, indicating its potential influence on various proteolytic activities involved in coagulation and fibrinolysis. Notably, TFPI2 does not affect thrombin. It is found in a complex with ABCB1, TFPI2, and PPP2R3C, leading to the dephosphorylation of ABCB1. This complex formation hints at potential regulatory mechanisms involving TFPI2 in modulating the phosphorylation state of ABCB1, which could have broader implications for cellular processes. Further exploration into the specific mechanisms and downstream effects of TFPI2's inhibitory functions and its interactions within the ABCB1-containing complex could provide valuable insights into its multifaceted role in the regulation of hemostasis and matrix remodeling.
Verified Bioactivity
Measured by its ability to inhibit proliferation of A549 human lung carcinoma cells. The ED50 this effect is 43.15 ng/mL, corresponding to a specific activity is 2.32×104 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Acta Pharmacol Sin
Lethal pulmonary thromboembolism in mice induced by intravenous human umbilical cord mesenchymal stem cell-derived large extracellular vesicles in a dose- and tissue factor-dependent manner. [Abstract]2024 Nov;45(11):2300-2312. PMID: 38914677
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
P48307 (D23-K213)
-
Molecular Construction
-
N-term
-
TFPI2 (D23-K213)
Accession # P48307 -
10*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TFPI2; Placental Protein 5; Tissue Factor Pathway Inhibitor 2; Retinal Pigment Epithelium Cell Factor 1; TFPI-2; Tissue Factor Pathway Inhibitor; PP5; TFPI2 Variant; REF1
-
AA Sequence
DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALK
-
Predicted Molecular Mass
21.8 kDa
-
Molecular Weight
Approximately 18-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
