1. Recombinant Proteins
  2. Others
  3. Thrombospondin-2 Protein, Mouse (His)

Thrombospondin-2 protein, also known as CD36 ligand, mediates anti-angiogenic properties. Thrombospondin-2 may regulate cell surface properties of mesenchymal cells and be involved in cell adhesion and migration. Thrombospondin-2 Protein, Mouse (His) is the recombinant mouse-derived Thrombospondin-2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Thrombospondin-2 protein, also known as CD36 ligand, mediates anti-angiogenic properties. Thrombospondin-2 may regulate cell surface properties of mesenchymal cells and be involved in cell adhesion and migration. Thrombospondin-2 Protein, Mouse (His) is the recombinant mouse-derived Thrombospondin-2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

Thrombospondin-2 protein is a disulfide-linked homotrimeric adhesion glycoprotein belonging to the thrombospondin family. Thrombospondin-2 is a CD36 ligand with anti-angiogenic properties that mediates cell-cell and cell-matrix interactions. Thrombospondin-2 may regulate cell surface properties of mesenchymal cells and be involved in cell adhesion and migration.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

Q03350 (G19-A232)

Gene ID

21826

Molecular Construction
N-term
6*His
Thrombospondin-2 (G19-A232)
Accession # Q03350
C-term
Protein Length

Partial

Synonyms
Thbs2; Tsp2; Thrombospondin-2
AA Sequence

GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA

Predicted Molecular Mass
28.1 kDa
Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Thrombospondin-2 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Thrombospondin-2 Protein, Mouse (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thrombospondin-2 Protein, Mouse (His)
Cat. No.:
HY-P702563
Quantity:
MCE Japan Authorized Agent: