TMSB4X/Thymosin beta 4 Protein, Human
Based on 1 Customer Validation
TMSB4X proteins play a critical role in cytoskeletal organization, influencing actin dynamics by binding and sequestering actin monomers. As a potent inhibitor of actin polymerization, it affects the cytoskeleton. TMSB4X/Thymosin beta 4 Protein, Human is the recombinant human-derived Thymosin beta 4 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TMSB4X proteins play a critical role in cytoskeletal organization, influencing actin dynamics by binding and sequestering actin monomers. As a potent inhibitor of actin polymerization, it affects the cytoskeleton. TMSB4X/Thymosin beta 4 Protein, Human is the recombinant human-derived Thymosin beta 4 protein, expressed by E. coli , with tag free.
Background
TMSB4X protein assumes a crucial role in cytoskeletal organization, as evidenced by its documented impact on actin dynamics. It functions by binding to and sequestering actin monomers (G actin), thereby acting as a potent inhibitor of actin polymerization. Beyond its influence on the cytoskeleton, TMSB4X emerges as a robust inhibitor of bone marrow-derived stem cell differentiation, exerting its effects by impeding the entry of hematopoietic pluripotent stem cells into the S-phase. These multifaceted functions underscore the significance of TMSB4X in orchestrating fundamental cellular processes, including cytoskeletal integrity and stem cell differentiation, highlighting its regulatory role in maintaining cellular homeostasis and orchestrating dynamic cellular responses.
Verified Bioactivity
1.The biological activity determined by its ability to produce a protective effect against hydrogen peroxide in primary lung fibroblasts is in a concentration range of 0.5 - 10 μg/mL.
2.Measured in inhibiting cell proliferation assay using A549 cells. The ED50 for this effect is <5 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P62328 (S2-S44)
-
Molecular Construction
-
N-term
-
TMSB4X (S2-S44)
Accession # P62328 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
TMSB4X; Prothymosin Beta-4; Prev. TMSB4; PTMB4; TB4X; THYB4; Thymosin Beta-4; FX; Thymosin, Beta 4, X Chromosome; Fx; T Beta-4; Thymosin Beta 4 X-Linked; Thymosin Beta
-
AA Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
-
Predicted Molecular Mass
4.9 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg; determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)