1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Tissue Inhibitor of Metalloproteinase (TIMPs)
  5. TIMP-1
  6. TIMP-1 Protein, Human (HEK293)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Background

TIMP-1, a metalloproteinase inhibitor, operates through the formation of one-to-one complexes with target metalloproteinases, including collagenases, leading to their irreversible inactivation by binding to the catalytic zinc cofactor. Its inhibitory spectrum encompasses MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13, and MMP16, excluding MMP14. Beyond its role as an enzyme inhibitor, TIMP-1 functions as a growth factor, orchestrating cell differentiation, migration, and cell death while activating intricate cellular signaling cascades through interactions with CD63 and ITGB1. This multifaceted protein also plays a crucial role in integrin signaling and, notably, mediates erythropoiesis in vitro, exhibiting species-specific stimulation of human and murine erythroid progenitors, distinct from IL3. Moreover, TIMP-1 engages in protein-protein interactions with MMP1, MMP3, MMP10, and MMP13, demonstrating its regulatory influence on these metalloproteinases. It forms a complex with CD63 and ITGB1, further emphasizing its involvement in complex cellular signaling networks.

In Vitro

TIMP-1 (12.5-400 ng/mL; 20 min) increases the the phosphorylation level of AKT and ERK1/2 in THP-1 monocytic cells. Moreover, TIMP-1 (100 ng/mL) also promotes the activation of serine/threonine kinases in THP-1 cells[1].
TIMP-1 also can stimulates THP cells to mediate cell migration and CD74 internalization (50-200 ng/mL; 1 h), with an optimal concentration of 100 ng/mL[1].

Biological Activity

Measured by its ability to inhibit human MMP-2 cleavage of a fluorogenic peptide substrate MCA-PLGL-DPA-AR-NH2 and the IC50 value is < 6 nM.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P01033 (C24-A207)

Gene ID
Molecular Construction
N-term
TIMP-1 (C24-A207)
Accession # P01033
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Metalloproteinase Inhibitor 1; EPA; TIMP-1; CLGI; TIMP
AA Sequence

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Predicted Molecular Mass
21 kDa
Molecular Weight

Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM NaAC, 200 mM NaCl, pH 5.5, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TIMP-1 Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TIMP-1 Protein, Human (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIMP-1 Protein, Human (HEK293)
Cat. No.:
HY-P73597
Quantity:
MCE Japan Authorized Agent: