Sting1/TMEM173 Protein, Human (Sumo-His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

The TMEM173 protein acts as a promoter of innate immune signaling, acting as a sensor of bacterial and viral cytoplasmic DNA, ultimately promoting the production of type I interferons (IFN-α and IFN-β). This innate immune response is triggered in response to the delivery of non-CpG double-stranded DNA from viruses and bacteria into the cytoplasm. Sting1/TMEM173 Protein, Human (Sumo-His) is the recombinant human-derived TMEM173 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The TMEM173 protein acts as a promoter of innate immune signaling, acting as a sensor of bacterial and viral cytoplasmic DNA, ultimately promoting the production of type I interferons (IFN-α and IFN-β). This innate immune response is triggered in response to the delivery of non-CpG double-stranded DNA from viruses and bacteria into the cytoplasm. Sting1/TMEM173 Protein, Human (Sumo-His) is the recombinant human-derived TMEM173 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

The TMEM173 protein acts as a facilitator of innate immune signaling, functioning as a sensor for cytosolic DNA from bacteria and viruses, ultimately promoting the production of type I interferon (IFN-alpha and IFN-beta). This innate immune response is triggered in response to non-CpG double-stranded DNA from viruses and bacteria delivered to the cytoplasm. TMEM173 recognizes and binds cyclic dinucleotides, specifically cyclic di-GMP (c-di-GMP), a second messenger produced by bacteria, and cyclic GMP-AMP (cGAMP), a messenger produced by CGAS in response to DNA virus in the cytosol. Upon binding to c-di-GMP or cGAMP, TMEM173 oligomerizes, translocates from the endoplasmic reticulum, and is phosphorylated by TBK1, leading to the recruitment and activation of the transcription factor IRF3. This induces the expression of type I interferon, establishing a potent anti-viral state. Additionally, TMEM173 plays a direct role in autophagy, with cGAMP-binding initiating ERGIC formation, which serves as the membrane source for autophagosome formation, targeting cytosolic DNA or DNA viruses for lysosomal degradation. The multifaceted activities of TMEM173 highlight its central role in orchestrating innate immune responses and autophagic processes, contributing to the cell's defense against viral and bacterial threats.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SUMO-6*His
    • TMEM173 (V155-V341)
      Accession # Q86WV6
    • C-term
  • Protein Length

    Full Length of Cyclic dinucleotide-binding domain (CBD) Region

  • Synonyms

    STING1; HSTING; Prev. TMEM173; N-Terminal Methionine-Proline-Tyrosine-Serine Plasma Membrane Tetraspanner; Transmembrane Protein 173; Stimulator Of Interferon Response CGAMP Interactor-DeltaC; STING; Stimulator Of Interferon Response CGAMP Interactor-Delt

  • AA Sequence

    VAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEV

  • Predicted Molecular Mass

    33.8 kDa

  • Molecular Weight

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM HEPES, 100 mM NaCl, 10% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00