Sting1/TMEM173 Protein, Human (Sumo-His)
Based on 2 publication(s) in Google Scholar
The TMEM173 protein acts as a promoter of innate immune signaling, acting as a sensor of bacterial and viral cytoplasmic DNA, ultimately promoting the production of type I interferons (IFN-α and IFN-β). This innate immune response is triggered in response to the delivery of non-CpG double-stranded DNA from viruses and bacteria into the cytoplasm. Sting1/TMEM173 Protein, Human (Sumo-His) is the recombinant human-derived TMEM173 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The TMEM173 protein acts as a promoter of innate immune signaling, acting as a sensor of bacterial and viral cytoplasmic DNA, ultimately promoting the production of type I interferons (IFN-α and IFN-β). This innate immune response is triggered in response to the delivery of non-CpG double-stranded DNA from viruses and bacteria into the cytoplasm. Sting1/TMEM173 Protein, Human (Sumo-His) is the recombinant human-derived TMEM173 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Background
The TMEM173 protein acts as a facilitator of innate immune signaling, functioning as a sensor for cytosolic DNA from bacteria and viruses, ultimately promoting the production of type I interferon (IFN-alpha and IFN-beta). This innate immune response is triggered in response to non-CpG double-stranded DNA from viruses and bacteria delivered to the cytoplasm. TMEM173 recognizes and binds cyclic dinucleotides, specifically cyclic di-GMP (c-di-GMP), a second messenger produced by bacteria, and cyclic GMP-AMP (cGAMP), a messenger produced by CGAS in response to DNA virus in the cytosol. Upon binding to c-di-GMP or cGAMP, TMEM173 oligomerizes, translocates from the endoplasmic reticulum, and is phosphorylated by TBK1, leading to the recruitment and activation of the transcription factor IRF3. This induces the expression of type I interferon, establishing a potent anti-viral state. Additionally, TMEM173 plays a direct role in autophagy, with cGAMP-binding initiating ERGIC formation, which serves as the membrane source for autophagosome formation, targeting cytosolic DNA or DNA viruses for lysosomal degradation. The multifaceted activities of TMEM173 highlight its central role in orchestrating innate immune responses and autophagic processes, contributing to the cell's defense against viral and bacterial threats.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Acta Pharm Sin B
Targeted inhibition of macrophage STING signaling alleviates inflammatory injury and ventricular remodeling in acute myocardial infarction. [Abstract]2025 Aug;15(8):4030-4046. PMID: 40893684 -
Phytomedicine
Direct inhibition of macrophage sting signaling by curcumol protects against myocardial infarction via attenuating the inflammatory response. [Abstract]2025 Mar:138:156403. PMID: 39889491
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
Q86WV6 (V155-V341)
-
Molecular Construction
-
N-term
-
SUMO-6*His
-
TMEM173 (V155-V341)
Accession # Q86WV6 -
C-term
-
-
Protein Length
Full Length of Cyclic dinucleotide-binding domain (CBD) Region
-
Synonyms
STING1; HSTING; Prev. TMEM173; N-Terminal Methionine-Proline-Tyrosine-Serine Plasma Membrane Tetraspanner; Transmembrane Protein 173; Stimulator Of Interferon Response CGAMP Interactor-DeltaC; STING; Stimulator Of Interferon Response CGAMP Interactor-Delt
-
AA Sequence
VAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEV
-
Predicted Molecular Mass
33.8 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM HEPES, 100 mM NaCl, 10% Glycerol, pH 8.0.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)