Copy Link Print Information

TMIGD1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TMIGD1 Protein, Human (HEK293, His)
  • TMIGD1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The TMIGD1 protein emerges as a potential regulator influencing diverse cellular processes, including cell-cell adhesion, migration, proliferation, and morphology. Additionally, TMIGD1 exhibits a protective role in renal epithelial cells by safeguarding them against oxidative cell injury, thereby promoting cell survival. The formation of homodimers by TMIGD1 indicates its ability to interact with itself, possibly playing a role in the modulation of its functional activities. The multifaceted nature of TMIGD1 in cellular regulation underscores its potential significance in maintaining cellular homeostasis and responding to environmental challenges. Further exploration is essential to uncover the specific molecular mechanisms through which TMIGD1 exerts its regulatory effects on cell behavior and survival.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    Q6UXZ0-1/NP_996663.1 (V30-P220)

  • Gene ID
    388364  [NCBI]
  • Molecular Construction
    • N-term
    • TMIGD1 (V30-P220)
      Accession # Q6UXZ0-1/NP_996663.1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TMIGD1; UNQ9372; Prev. TMIGD; AWKS9372; Transmembrane And Immunoglobulin Domain Containing 1; Transmembrane And Immunoglobulin Domain-Containing Protein 1

  • AA Sequence

    VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

  • Predicted Molecular Mass

    21.1 kDa

  • Molecular Weight

    Approximately 37-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • TMIGD1 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for TMIGD1 Protein, Human (HEK293, His)
  • TMIGD1 Protein, Human (HEK293, His) Product Image