1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Serpin (Protease Inhibitor)
  5. TMPRSS1/HPN Protein, Human (HEK293, His)

TMPRSS1/HPN is a serine protease that cleaves extracellular substrates and is involved in the proteolytic processing of growth factors such as HGF and MST1/HGFL. In addition to growth factor regulation, TMPRSS1/HPN is also critical for cell growth and morphology maintenance. TMPRSS1/HPN Protein, Human (HEK293, His) is the recombinant human-derived TMPRSS1/HPN protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TMPRSS1/HPN is a serine protease that cleaves extracellular substrates and is involved in the proteolytic processing of growth factors such as HGF and MST1/HGFL. In addition to growth factor regulation, TMPRSS1/HPN is also critical for cell growth and morphology maintenance. TMPRSS1/HPN Protein, Human (HEK293, His) is the recombinant human-derived TMPRSS1/HPN protein, expressed by HEK293 , with C-His labeled tag.

Background

TMPRSS1/HPN, a serine protease, is involved in the cleavage of various extracellular substrates, contributing to the proteolytic processing of growth factors such as HGF and MST1/HGFL. Beyond its role in growth factor regulation, TMPRSS1/HPN plays a significant part in cell growth and the maintenance of cell morphology. Additionally, this protease is implicated in the proteolytic processing of ACE2, emphasizing its involvement in crucial cellular pathways. Notably, TMPRSS1/HPN mediates the proteolytic cleavage of urinary UMOD, a process essential for the polymerization of UMOD, underscoring its multifunctional role in modulating various biological processes.

Biological Activity

Immobilized Human HPN, His Tag at 2 μg/mL (100 μl/Well) on the plate. Dose response curve for Anti-HPN Antibody, hFc Tag with the EC50 of ≤20.0 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-10*His

Accession

P05981 (R45-L417)

Gene ID
Molecular Construction
N-term
TMPRSS1 (R45-L417)
Accession # P05981
10*His
C-term
Protein Length

Extracellular Domain

Synonyms
Hpxn; FLJ56652; Hemopexin; HPX; HX; Hepsin; HPN; TMPRSS1
AA Sequence

RSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL

Molecular Weight

18-22 kDa&30 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM NaAc,150 mM NaCl, pH 5.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 20 mM NaAc, 150 mM NaCl, pH 5.0.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TMPRSS1/HPN Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TMPRSS1/HPN Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMPRSS1/HPN Protein, Human (HEK293, His)
Cat. No.:
HY-P77693
Quantity:
MCE Japan Authorized Agent: