Copy Link Print Information

TMPRSS1/HPN Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

TMPRSS1/HPN is a serine protease that cleaves extracellular substrates and is involved in the proteolytic processing of growth factors such as HGF and MST1/HGFL. In addition to growth factor regulation, TMPRSS1/HPN is also critical for cell growth and morphology maintenance. TMPRSS1/HPN Protein, Human (HEK293, His) is the recombinant human-derived TMPRSS1/HPN protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TMPRSS1/HPN Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TMPRSS1/HPN is a serine protease that cleaves extracellular substrates and is involved in the proteolytic processing of growth factors such as HGF and MST1/HGFL. In addition to growth factor regulation, TMPRSS1/HPN is also critical for cell growth and morphology maintenance. TMPRSS1/HPN Protein, Human (HEK293, His) is the recombinant human-derived TMPRSS1/HPN protein, expressed by HEK293 , with C-His labeled tag.

Background

TMPRSS1/HPN, a serine protease, is involved in the cleavage of various extracellular substrates, contributing to the proteolytic processing of growth factors such as HGF and MST1/HGFL. Beyond its role in growth factor regulation, TMPRSS1/HPN plays a significant part in cell growth and the maintenance of cell morphology. Additionally, this protease is implicated in the proteolytic processing of ACE2, emphasizing its involvement in crucial cellular pathways. Notably, TMPRSS1/HPN mediates the proteolytic cleavage of urinary UMOD, a process essential for the polymerization of UMOD, underscoring its multifunctional role in modulating various biological processes.

Verified Bioactivity

Immobilized Human HPN, His Tag at 2 μg/mL (100 μl/Well) on the plate. Dose response curve for Anti-HPN Antibody, hFc Tag with the EC50 of ≤20.0 ng/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession

    P05981 (R45-L417)

  • Gene ID
    3249  [NCBI]
  • Molecular Construction
    • N-term
    • TMPRSS1 (R45-L417)
      Accession # P05981
    • 10*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    HPN; Serine Protease Hepsin; Hepsin; Transmembrane Protease, Serine 1; TMPRSS1; Testicular Tissue Protein Li 85; Transmembrane Protease Serine 1; Alternative Protein HPN

  • AA Sequence

    RSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL

  • Predicted Molecular Mass

    42 kDa

  • Molecular Weight

    Approximately 18-22 kDa & 30 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM NaAc,150 mM NaCl, pH 5.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 20 mM NaAc, 150 mM NaCl, pH 5.0.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TMPRSS1/HPN Protein, Human (HEK293, His) Product Image
    1/16
  • TMPRSS1/HPN Protein, Human (HEK293, His) Product Image