Copy Link Print Information

TNF RII/TNFRSF1B Protein, Human (183a.a)

Customer Review

Based on 1 Customer Validation

The TNFRII protein is a receptor with high affinity for TNFSF2/TNF-α and low affinity for TNFSF1/lymphotoxin-α, and plays a key role in mediating the metabolic effects of TNF-α. The TRAF1/TRAF2 complex recruits BIRC2 and BIRC3 to TNFRSF1B/TNFR2 to regulate the apoptotic pathway. TNFRII Protein, Human (183a.a) is the recombinant human-derived TNFRII protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TNF RII/TNFRSF1B Protein, Human (183a.a)
  • Experimental Validation Results for TNF RII/TNFRSF1B Protein, Human (183a.a)
  • TNF RII/TNFRSF1B Protein, Human (183a.a) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The TNFRII protein is a receptor with high affinity for TNFSF2/TNF-α and low affinity for TNFSF1/lymphotoxin-α, and plays a key role in mediating the metabolic effects of TNF-α. The TRAF1/TRAF2 complex recruits BIRC2 and BIRC3 to TNFRSF1B/TNFR2 to regulate the apoptotic pathway. TNFRII Protein, Human (183a.a) is the recombinant human-derived TNFRII protein, expressed by E. coli , with tag free.

Background

The TNFRII protein serves as a receptor with a high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2, thereby modulating apoptotic pathways. This receptor plays a pivotal role in mediating the majority of the metabolic effects induced by TNF-alpha. Notably, its isoform 2 exhibits the ability to block TNF-alpha-induced apoptosis, suggesting a regulatory role in antagonizing the biological activity of TNF-alpha. Furthermore, TNFRII binds to TRAF2, highlighting its involvement in downstream signaling cascades. Additionally, interactions with BMX and the activated form of XPNPEP3 further contribute to the complexity of its molecular associations.

Verified Bioactivity

Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 0.125 μg/mL in the presence of 1.25 ng/mL of recombinant Human TNF-alpha. Corresponding to a specific activity is 8×10^3U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 0.125 μg/mL in the presence of 1.25 ng/mL of recombinant Human TNF-alpha. Corresponding to a specific activity is 8×103U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P20333-1 (P24-T206)

  • Gene ID
    7133  [NCBI]
  • Molecular Construction
    • N-term
    • TNFRII (P24-T206)
      Accession # P20333-1
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    TNFRSF1B; TNF-R2; Prev. TNFR2; Tumor Necrosis Factor Receptor Superfamily, Member 1B; TNFBR; Tumor Necrosis Factor Receptor Superfamily, Member 1b; P75; Tumor Necrosis Factor Binding Protein 2; TNF-R-II; Tumor Necrosis Factor Beta Receptor; TNF-R75; Solub

  • AA Sequence

    PAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT

  • Predicted Molecular Mass

    19.8 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 0.125 μg/mL in the presence of 1.25 ng/mL of recombinant Human TNF-alpha. Corresponding to a specific activity is 8×103U/mg.

  • TNF RII/TNFRSF1B Protein, Human (183a.a) Product Image
    1/16
  • Experimental Validation Results for TNF RII/TNFRSF1B Protein, Human (183a.a)
  • Experimental Validation Results for TNF RII/TNFRSF1B Protein, Human (183a.a)
  • TNF RII/TNFRSF1B Protein, Human (183a.a) Product Image