RANK/TNFRSF11A Protein, Human
Based on 1 Customer Validation
RANK/TNFRSF11A protein is the receptor of TNFSF11/RANKL and is critical for RANKL-induced osteoclastogenesis. It interacts with EEIG1 to promote osteoclast formation by promoting NFATC1 transcription and activating PLCG2. RANK/TNFRSF11A Protein, Human is the recombinant human-derived RANK/TNFRSF11A protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
RANK/TNFRSF11A protein is the receptor of TNFSF11/RANKL and is critical for RANKL-induced osteoclastogenesis. It interacts with EEIG1 to promote osteoclast formation by promoting NFATC1 transcription and activating PLCG2. RANK/TNFRSF11A Protein, Human is the recombinant human-derived RANK/TNFRSF11A protein, expressed by E. coli , with tag free.
The RANK/TNFRSF11A protein functions as the receptor for TNFSF11/RANKL/TRANCE/OPGL, playing a crucial role in the essential process of RANKL-mediated osteoclastogenesis. Interacting with EEIG1, it promotes osteoclast formation by facilitating the transcription of NFATC1 and activating PLCG2. Beyond its role in bone metabolism, RANK/TNFRSF11A is involved in regulating interactions between T-cells and dendritic cells. The protein binds to the clefts between the subunits of the TNFSF11 ligand trimer, forming a heterohexamer. It is also a key component of a complex comprising EEIG1, TNFRSF11A/RANK, PLCG2, GAB2, TEC, and BTK, with complex formation increasing in the presence of TNFSF11/RANKL. Additionally, RANK/TNFRSF11A interacts with TRAF family members (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) and GAB2, further contributing to its regulatory functions in diverse cellular processes.
Measured by its binding ability in a functional ELISA. Immobilized Human RANK/TNFRSF11A at 2 μg/mL (100 μL/well) can bind Human RANKL/TNFSF11, Human (HY-P73387). The ED50 for this effect is 7.235 ng/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9Y6Q6-1 (Q29-K202)
-
Molecular Construction
-
N-term
-
RANK (Q29-K202)
Accession # Q9Y6Q6-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
TNFRSF11A; Familial Expansile Osteolysis; Prev. LOH18CR1; Paget Disease Of Bone 2; Prev. PDB2; TRANCE Receptor; RANK; Tumor Necrosis Factor Receptor Superfamily, Member 11a, Activator Of NFKB; ODFR; Receptor Activator Of Nuclear Factor Kappa B; Osteoclast
-
AA Sequence
QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK
-
Predicted Molecular Mass
19.1 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
