RANK/TNFRSF11A Protein, Human

RANK/TNFRSF11A protein is the receptor of TNFSF11/RANKL and is critical for RANKL-induced osteoclastogenesis. It interacts with EEIG1 to promote osteoclast formation by promoting NFATC1 transcription and activating PLCG2. RANK/TNFRSF11A Protein, Human is the recombinant human-derived RANK/TNFRSF11A protein, expressed by E. coli , with tag free.

The RANK/TNFRSF11A protein functions as the receptor for TNFSF11/RANKL/TRANCE/OPGL, playing a crucial role in the essential process of RANKL-mediated osteoclastogenesis. Interacting with EEIG1, it promotes osteoclast formation by facilitating the transcription of NFATC1 and activating PLCG2. Beyond its role in bone metabolism, RANK/TNFRSF11A is involved in regulating interactions between T-cells and dendritic cells. The protein binds to the clefts between the subunits of the TNFSF11 ligand trimer, forming a heterohexamer. It is also a key component of a complex comprising EEIG1, TNFRSF11A/RANK, PLCG2, GAB2, TEC, and BTK, with complex formation increasing in the presence of TNFSF11/RANKL. Additionally, RANK/TNFRSF11A interacts with TRAF family members (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) and GAB2, further contributing to its regulatory functions in diverse cellular processes.

Measured by its binding ability in a functional ELISA. Immobilized Human RANK/TNFRSF11A at 2 μg/mL (100 μL/well) can bind Human RANKL/TNFSF11, Human (HY-P73387). The ED₅₀ for this effect is 7.235 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human RANK/TNFRSF11A at 2 μg/mL (100 μL/well) can bind Human RANKL/TNFSF11, Human (HY-P73387). The ED₅₀ for this effect is 7.235 ng/mL.

Human

E. coli

Tag Free

Q9Y6Q6-1 (Q29-K202)

8792  [NCBI]

Partial

QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.