RANK/TNFRSF11A Protein, Human

Customer Review

Based on 1 Customer Validation

RANK/TNFRSF11A protein is the receptor of TNFSF11/RANKL and is critical for RANKL-induced osteoclastogenesis. It interacts with EEIG1 to promote osteoclast formation by promoting NFATC1 transcription and activating PLCG2. RANK/TNFRSF11A Protein, Human is the recombinant human-derived RANK/TNFRSF11A protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RANK/TNFRSF11A protein is the receptor of TNFSF11/RANKL and is critical for RANKL-induced osteoclastogenesis. It interacts with EEIG1 to promote osteoclast formation by promoting NFATC1 transcription and activating PLCG2. RANK/TNFRSF11A Protein, Human is the recombinant human-derived RANK/TNFRSF11A protein, expressed by E. coli , with tag free.

Background

The RANK/TNFRSF11A protein functions as the receptor for TNFSF11/RANKL/TRANCE/OPGL, playing a crucial role in the essential process of RANKL-mediated osteoclastogenesis. Interacting with EEIG1, it promotes osteoclast formation by facilitating the transcription of NFATC1 and activating PLCG2. Beyond its role in bone metabolism, RANK/TNFRSF11A is involved in regulating interactions between T-cells and dendritic cells. The protein binds to the clefts between the subunits of the TNFSF11 ligand trimer, forming a heterohexamer. It is also a key component of a complex comprising EEIG1, TNFRSF11A/RANK, PLCG2, GAB2, TEC, and BTK, with complex formation increasing in the presence of TNFSF11/RANKL. Additionally, RANK/TNFRSF11A interacts with TRAF family members (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) and GAB2, further contributing to its regulatory functions in diverse cellular processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human RANK/TNFRSF11A at 2 μg/mL (100 μL/well) can bind Human RANKL/TNFSF11, Human (HY-P73387). The ED50 for this effect is 7.235 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human RANK/TNFRSF11A at 2 μg/mL (100 μL/well) can bind Human RANKL/TNFSF11, Human (HY-P73387). The ED50 for this effect is 7.235 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • RANK (Q29-K202)
      Accession # Q9Y6Q6-1
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    TNFRSF11A; Familial Expansile Osteolysis; Prev. LOH18CR1; Paget Disease Of Bone 2; Prev. PDB2; TRANCE Receptor; RANK; Tumor Necrosis Factor Receptor Superfamily, Member 11a, Activator Of NFKB; ODFR; Receptor Activator Of Nuclear Factor Kappa B; Osteoclast

  • AA Sequence

    QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK

  • Predicted Molecular Mass

    19.1 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00