TPM4 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The TPM4 protein binds actin filaments in muscle and non-muscle cells and critically regulates calcium-dependent muscle contraction with the help of the vertebrate troponin complex. In smooth muscle cells, TPM4 interacts with caldesmon and contributes to contraction regulation. TPM4 Protein, Human (HEK293, His) is the recombinant human-derived TPM4 protein, expressed by HEK293 , with N-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TPM4 protein binds actin filaments in muscle and non-muscle cells and critically regulates calcium-dependent muscle contraction with the help of the vertebrate troponin complex. In smooth muscle cells, TPM4 interacts with caldesmon and contributes to contraction regulation. TPM4 Protein, Human (HEK293, His) is the recombinant human-derived TPM4 protein, expressed by HEK293 , with N-6*His labeled tag.
Background
TPM4 protein exhibits binding specificity to actin filaments in both muscle and non-muscle cells, playing a pivotal role, particularly in conjunction with the troponin complex, in the calcium-dependent regulation of striated muscle contraction in vertebrates. In smooth muscle cells, TPM4 contributes to the regulation of contraction through interaction with caldesmon. In non-muscle cells, TPM4 is implicated in stabilizing actin filaments within the cytoskeleton. Additionally, TPM4 has a calcium-binding capacity, as demonstrated in studies. It forms homodimers and heterodimers, the latter composed of an alpha chain (TPM1, TPM3, or TPM4) and a beta chain (TPM2), showcasing its versatility in molecular configurations. The multifaceted interactions of TPM4 underscore its essential roles in both muscle contraction and cytoskeletal dynamics across diverse cellular contexts.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-6*His
-
Accession
P67936 (A2-I248)
-
Molecular Construction
-
N-term
-
6*His
-
TPM4 (A2-I248)
Accession # P67936 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
TPM4; TM30p1; Tropomyosin 4; Tropomyosin-4; Epididymis Secretory Protein Li 108; HEL-S-108; Tropomyosin Alpha-4 Chain; BDPLT25
-
AA Sequence
AGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
-
Predicted Molecular Mass
28.4 kDa
-
Molecular Weight
Approximately 30-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
