TPSAB1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Tryptase alpha/beta 1 protein (TPSAB1) belongs to a family of trypsin-like serine proteases, and is enzymatically active and get involved in proteolysis only as heparin-stabilized tetramers, TPSAB1 is also resistant to all known endogenous proteinase inhibitors. Beta tryptase appears to be the main isoenzymes expressed in mast cells; while alpha tryptase is predominate in basophils. TPSAB1 Protein, Human (HEK293, His) is the recombinant human-derived TPSAB1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Tryptase alpha/beta 1 protein (TPSAB1) belongs to a family of trypsin-like serine proteases, and is enzymatically active and get involved in proteolysis only as heparin-stabilized tetramers, TPSAB1 is also resistant to all known endogenous proteinase inhibitors. Beta tryptase appears to be the main isoenzymes expressed in mast cells; while alpha tryptase is predominate in basophils. TPSAB1 Protein, Human (HEK293, His) is the recombinant human-derived TPSAB1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Tryptase alpha/beta 1 protein (TPSAB1) belongs to a family of trypsin-like serine proteases, the peptidase family S1. TPSAB1is enzymatically active and get involved in proteolysis only as heparin-stabilized tetramers, and TPSAB1is resistant to all known endogenous proteinase inhibitors. Beta tryptase appears to be the main isoenzymes expressed in mast cells; whereas in basophils, alpha tryptase predominate. TPSAB1 has been implicated as mediators in the pathogenesis of asthma, inflammatory bowel disease, inflammatory arthritis and other allergic and inflammatory disorders[1][2][3][4].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TPSAB1 (I31-P275)
      Accession # Q86TM8
    • 6*His
    • C-term
  • Protein Length

    Full Length of Peptidase S1 Domain

  • Synonyms

    TPSAB1; Epididymis Secretory Sperm Binding Protein; Prev. TPSB1; Mast Cell Beta I Tryptase; Prev. TPS1; Tryptase Beta 1; Prev. TPS2; Tryptase Beta-2; Tryptase Alpha/Beta-1; Tryptase Beta-1; Mast Cell Tryptase; TPSAB1 Protein; Tryptase Alpha II; Tryptase-I

  • AA Sequence

    IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCLGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWDEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

  • Predicted Molecular Mass

    28.8 kDa

  • Molecular Weight

    Approximately 32-38 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 1 M NaCl, 0.05 mM Heparin, 50 mM sodium acetate, containing 0.01% sodium azide, pH 5.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00