TRDC Protein, Human (HEK293, His)
TRDC Protein, Human (HEK293, His) is the recombinant human-derived TRDC protein, expressed by HEK293, with C-His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TRDC Protein, Human (HEK293, His) is the recombinant human-derived TRDC protein, expressed by HEK293, with C-His tag.
Background
TRDC is the constant region of the T cell receptor (TR) delta chain involved in antigen recognition. Gamma-delta TRs recognize diverse self and foreign non-peptide antigens, often expressed at epithelial host-environment interfaces, including endogenous lipids presented by MH-like protein CD1D and phosphoantigens presented by butyrophilin-like molecule BTN3A1. Antigen recognition triggers rapid, innate-like immune responses for pathogen clearance and tissue repair. Binding of gamma-delta TR complex to antigen induces phosphorylation of immunoreceptor tyrosine-based activation motifs (ITAMs) in CD3 chains by LCK and FYN kinases, recruiting and activating ZAP70 to phosphorylate scaffolding proteins LCP2 and LAT. This forms a supramolecular signalosome recruiting phospholipase PLCG1, leading to calcium mobilization and ERK activation, ultimately driving T cell expansion and effector differentiation. Gamma-delta TRs are generated through somatic rearrangement of limited variable (V), diversity (D), and joining (J) gene segments. Their diversity stems from tandem (D) gene rearrangement and utilization of all three reading frames, further enhanced by exonuclease trimming and random nucleotide (N) additions during V-(D)-J recombination.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
B7Z8K6 (S1-V129)
-
Gene ID/
-
Molecular Construction
-
N-term
-
TRDC (S1-V129)
Accession # B7Z8K6 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TRDC; TCRD; T Cell Receptor Delta Constant
-
AA Sequence
SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTV
-
Predicted Molecular Mass
16.4 kDa
-
Molecular Weight
Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)