TREML1 Protein, Mouse (HEK293, hFc)
TREML1 is a trigger receptor 1 expressed on myeloid cells that activates myeloid cells via the adaptor protein DAP12. TREML1 promotes microglial phagocytosis of Aβ and is associated with the immune response to AD. TREML1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TREML1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TREML1 is a trigger receptor 1 expressed on myeloid cells that activates myeloid cells via the adaptor protein DAP12. TREML1 promotes microglial phagocytosis of Aβ and is associated with the immune response to AD. TREML1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TREML1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
TREML1 is a trigger receptor 1 expressed on myeloid cells, and monocytes/macrophages and blood neutrophils are the main effector cells in the innate response to human TREML1. TREML1 activates myeloid cells through the adaptor protein DAP12. TREMs family not only participate in the regulation of microglial phagocytosis and amyloid clearance but also play an indispensable role in the neuroinflammatory response of AD. TREML1 promotes microglial phagocytosis of Aβ and is associated with the immune response to AD[1][2][3].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q8K558-2/AAL85488.1 (D21-Q175)
-
Molecular Construction
-
N-term
-
TREML1 (D21-Q175)
Accession # Q8K558-2/AAL85488.1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TREML1; TLT-1; Triggering Receptor Expressed On Myeloid Cells Like 1; Triggering Receptor Expressed On Myeloid Cells-Like 1; TLT1; TREM-Like Transcript 1; DJ238O23.3; GLTL1825; Triggering Receptor Expressed On Myeloid Cells-Like Protein 1; PRO3438; Trem-L
-
AA Sequence
DSHPEVLQAPVGSSILVQCHYRLQDVRALKVWCQFLQEGCHPLVTSAVDRRAPGNGRIFLTDLGGGLLQVEMVTLQEEDTGEYGCVVEGAAGPQTLHRVSLLVLPPVPGPREGEEAEDEKETYRIGTGSLLEDPSLDPSASAGPHEFRRRENRCQ
-
Predicted Molecular Mass
43.6 kDa
-
Molecular Weight
Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
