TrkA Protein, Human (sf9, Flag, Avi)
TrkA protein is an important receptor tyrosine kinase that regulates the development of the central and peripheral nervous systems and affects the proliferation, differentiation, and survival of neurons. As a high-affinity receptor for NGF, TrkA is activated upon NGF binding through homodimerization and autophosphorylation. TrkA, Human (sf9, Flag, Avi) is the recombinant human-derived TrkA protein, expressed by sf9 insect cells, with N-His;N-GST labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
TrkA protein is an important receptor tyrosine kinase that regulates the development of the central and peripheral nervous systems and affects the proliferation, differentiation, and survival of neurons. As a high-affinity receptor for NGF, TrkA is activated upon NGF binding through homodimerization and autophosphorylation. TrkA, Human (sf9, Flag, Avi) is the recombinant human-derived TrkA protein, expressed by sf9 insect cells, with N-His;N-GST labeled tag.
TrkA Protein, a receptor tyrosine kinase, plays a crucial role in the development and maturation of both the central and peripheral nervous systems, exerting control over the proliferation, differentiation, and survival of sympathetic and sensory neurons. Functioning as a high-affinity receptor for NGF, its primary ligand, TrkA undergoes homodimerization, autophosphorylation, and activation upon dimeric NGF ligand-binding. This activation leads to the recruitment, phosphorylation, and/or activation of downstream effectors, including SHC1, FRS2, SH2B1, SH2B2, and PLCG1, orchestrating distinct signaling cascades that drive cell survival and differentiation. TrkA regulates diverse cellular processes through pathways such as the GRB2-Ras-MAPK cascade, Ras-PI3 kinase-AKT1 signaling, and NF-Kappa-B activation. In the absence of ligand and activation, TrkA may contribute to cell death, emphasizing the dependence of neuron survival on trophic factors. Interestingly, it exhibits resistance to NGF, constitutively activating AKT1 and NF-kappa-B, while unable to activate the Ras-MAPK signaling cascade. TrkA also antagonizes the anti-proliferative NGF-NTRK1 signaling, promoting neuronal precursor differentiation. The isoform TrkA-III additionally plays a role in angiogenesis and exhibits oncogenic activity upon overexpression.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-Avi;N-Flag
-
Accession
P04629-2 (C436-G790)
-
Gene ID4914
-
Molecular Construction
-
N-term
-
Flag-Avi
-
(C436-G790)
Accession # P04629-2 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
NTRK1; Tyrosine Kinase Receptor A; Neurotrophic Receptor Tyrosine Kinase 1; P140-TrkA; TRKA; Gp140trk; TRK; Trk-A; MTC; Neurotrophic Tyrosine Kinase Receptor Type 1; High Affinity Nerve Growth Factor Receptor; Tyrosine-Protein Kinase Receptor; Neurotrophi
-
AA Sequence
CGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)