1. Recombinant Proteins
  2. CAR-T related Proteins
  3. TROP-2
  4. TROP-2 Protein, Human (HEK 293, hFc)

TROP-2 Protein, Human (HEK 293, hFc)

Cat. No.: HY-P72015
Handling Instructions
Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Biological Activity
Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/mL.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

P09758 (H27-T274)

Gene ID
Synonyms
Cell surface glycoprotein Trop 2; Cell surface glycoprotein Trop-2; Cell surface glycoprotein Trop2; Epithelial glycoprotein 1; GA733 1; GA7331; M1S 1; M1S1; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733 1 ; Pancreatic carcinoma marker protein GA733-1; Pancreatic carcinoma marker protein GA7331 ; TACD 2; TACD2_HUMAN; TACSTD 2; Tacstd2; Trop 2; Trop2; Tumor associated calcium signal transducer 2 precursor ; Tumor-associated calcium signal transducer 2
AA Sequence

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Weight

Approximately 56.8 kDa

Purity

Greater than 90% as determined by SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

TROP-2 Protein, Human (HEK 293, hFc) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TROP-2 Protein, Human (HEK 293, hFc)
Cat. No.:
HY-P72015
Quantity:
MCE Japan Authorized Agent: