TROP-2 Protein, Human (HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (HEK293, His-Avi) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (HEK293, His-Avi) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Background

The TROP-2 protein emerges as a potential growth factor receptor, suggesting its involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth, proliferation, and potentially other cellular functions. The specific ligands and downstream pathways associated with TROP-2-mediated growth factor signaling remain areas for further investigation. Unraveling the detailed molecular mechanisms and functional implications of TROP-2 in growth factor signaling will contribute to a comprehensive understanding of its role in cellular physiology and may open avenues for therapeutic interventions targeting this receptor.

Verified Bioactivity

NA

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TROP-2 (H27-T274)
      Accession # P09758
    • Avi-6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TACSTD2; Epithelial Glycoprotein-1; Prev. M1S1; Membrane Component, Chromosome 1, Surface Marker 1; GA733-1; Gastrointestinal Tumor-Associated Antigen GA7331; TROP2; Pancreatic Carcinoma Marker Protein GA7331; Tumor-Associated Calcium Signal Transducer 2;

  • AA Sequence

    HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

  • Predicted Molecular Mass

    30.5 kDa

  • Molecular Weight

    Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00