TXK Protein, Human (sf9, 268a.a, His, GST)

TXK protein is a non-receptor tyrosine kinase that cooperates with ITK to regulate adaptive immune responses. TXK is activated by the T cell receptor (TCR) and is phosphorylated at Tyr-420 after being recruited to the cell membrane, affecting the development, function and differentiation of T cells. TXK Protein, Human (sf9, 268a.a, His, GST) is the recombinant human-derived TXK protein, expressed by sf9 insect cells , with His, GST labeled tag.

TXK Protein, a non-receptor tyrosine kinase, plays a redundant role with ITK in regulating the adaptive immune response, exerting influence over the development, function, and differentiation of both conventional T-cells and nonconventional NKT-cells. Upon activation of the T-cell receptor (TCR) by antigen-presenting cells (APC), a phosphorylation cascade ensues, culminating in the recruitment of TXK to the cell membrane and subsequent phosphorylation at Tyr-420, leading to its full activation. Beyond its pivotal role in TCR signaling, TXK contributes to diverse downstream pathways, including the regulation of the actin cytoskeleton. Analogous to ITK, TXK phosphorylates PLCG1, facilitating its localization in lipid rafts and activation, ultimately triggering the release of calcium from the endoplasmic reticulum into the cytoplasm. This cascade activates the nuclear factor of activated T-cells (NFAT), which translocates into the nucleus to execute its transcriptional functions. TXK also plays a crucial role in the positive regulation of IFNG transcription in T-helper 1 cells, forming an IFNG promoter-binding complex with PARP1 and EEF1A1, where it phosphorylates both PARP1 and EEF1A1. Additionally, TXK phosphorylates key sites in LCP2, leading to the up-regulation of the Th1-preferred cytokine IL-2. Furthermore, TXK phosphorylates 'Tyr-201' of CTLA4, facilitating the association of PI-3 kinase with the CTLA4 receptor.

Human

Sf9 insect cells

N-8*His;N-GST

P42681 (S260-W527)

7294

Partial

SYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKAINEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEYVSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISEGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.