1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Protein Tyrosine Kinases TK
  4. Tec
  5. TXK
  6. TXK Protein, Human (sf9, 268a.a, His, GST)

TXK protein is a non-receptor tyrosine kinase that cooperates with ITK to regulate adaptive immune responses. TXK is activated by the T cell receptor (TCR) and is phosphorylated at Tyr-420 after being recruited to the cell membrane, affecting the development, function and differentiation of T cells. TXK Protein, Human (sf9, 268a.a, His, GST) is the recombinant human-derived TXK protein, expressed by sf9 insect cells , with His, GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TXK protein is a non-receptor tyrosine kinase that cooperates with ITK to regulate adaptive immune responses. TXK is activated by the T cell receptor (TCR) and is phosphorylated at Tyr-420 after being recruited to the cell membrane, affecting the development, function and differentiation of T cells. TXK Protein, Human (sf9, 268a.a, His, GST) is the recombinant human-derived TXK protein, expressed by sf9 insect cells , with His, GST labeled tag.

Background

TXK Protein, a non-receptor tyrosine kinase, plays a redundant role with ITK in regulating the adaptive immune response, exerting influence over the development, function, and differentiation of both conventional T-cells and nonconventional NKT-cells. Upon activation of the T-cell receptor (TCR) by antigen-presenting cells (APC), a phosphorylation cascade ensues, culminating in the recruitment of TXK to the cell membrane and subsequent phosphorylation at Tyr-420, leading to its full activation. Beyond its pivotal role in TCR signaling, TXK contributes to diverse downstream pathways, including the regulation of the actin cytoskeleton. Analogous to ITK, TXK phosphorylates PLCG1, facilitating its localization in lipid rafts and activation, ultimately triggering the release of calcium from the endoplasmic reticulum into the cytoplasm. This cascade activates the nuclear factor of activated T-cells (NFAT), which translocates into the nucleus to execute its transcriptional functions. TXK also plays a crucial role in the positive regulation of IFNG transcription in T-helper 1 cells, forming an IFNG promoter-binding complex with PARP1 and EEF1A1, where it phosphorylates both PARP1 and EEF1A1. Additionally, TXK phosphorylates key sites in LCP2, leading to the up-regulation of the Th1-preferred cytokine IL-2. Furthermore, TXK phosphorylates 'Tyr-201' of CTLA4, facilitating the association of PI-3 kinase with the CTLA4 receptor.

Species

Human

Source

Sf9 insect cells

Tag

N-8*His;N-GST

Accession

P42681 (S260-W527)

Gene ID

7294

Protein Length

Partial

Synonyms
TXK; Tyrosine-protein kinase TXK; Protein-tyrosine kinase 4; Resting lymphocyte kinase
AA Sequence

SYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKAINEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEYVSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISEGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TXK Protein, Human (sf9, 268a.a, His, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TXK Protein, Human (sf9, 268a.a, His, GST)
Cat. No.:
HY-P701655
Quantity:
MCE Japan Authorized Agent: