TXNDC12 Protein, Human (HEK293, His)
The TXNDC12 protein is an important endoplasmic reticulum-localized protein disulfide bond reductase that plays a key role in promoting disulfide bond formation in client proteins. As an essential component of cellular machinery, TXNDC12 contributes to complex protein folding processes, highlighting its importance in maintaining correct protein structure and function. TXNDC12 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC12 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TXNDC12 protein is an important endoplasmic reticulum-localized protein disulfide bond reductase that plays a key role in promoting disulfide bond formation in client proteins. As an essential component of cellular machinery, TXNDC12 contributes to complex protein folding processes, highlighting its importance in maintaining correct protein structure and function. TXNDC12 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC12 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
TXNDC12 protein, a crucial protein-disulfide reductase localized in the endoplasmic reticulum, plays a pivotal role in promoting the formation of disulfide bonds in client proteins by virtue of its thiol-disulfide oxidase activity. As an essential component of the cellular machinery, TXNDC12 contributes to the intricate processes of protein folding and maturation within the endoplasmic reticulum. Its catalytic function in facilitating disulfide bond formation underscores its significance in maintaining proper protein structure and function, reflecting its central role in cellular homeostasis and the quality control mechanisms of protein processing in the endoplasmic reticulum.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
O95881 (H27-L168)
-
Molecular Construction
-
N-term
-
TXNDC12 (H27-L168)
Accession # O95881 -
6*His
-
C-term
-
-
Protein Length
Full Length of Thioredoxin domain-containing protein 12 Chain
-
Synonyms
TXNDC12; TLP19; Thioredoxin domain-containing protein 12; EC 1.8.4.2; Endoplasmic reticulum resident protein 18; ER protein 18; ERp18; Endoplasmic reticulum resident protein 19; ER protein 19; ERp19; Thioredoxin-like protein p19; hTLP19; Thioredoxin Domai
-
AA Sequence
HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHL
-
Predicted Molecular Mass
17 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
