TYRO3/DTK Protein, Human (Biotinylated, sf9, Flag, Avi)
TYRO3/DTK protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as TULP1 or GAS6. TYRO3 is activated by ligand binding and regulates cell survival, migration, and differentiation, leading to dimerization and intracellular autophosphorylation to create docking sites for downstream signaling molecules. TYRO3/DTK Protein, Human (Biotinylated, sf9, Flag, Avi) is the recombinant human-derived TYRO3, expressed by Sf9 insect cells, with Avi, Flag labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
TYRO3/DTK protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as TULP1 or GAS6. TYRO3 is activated by ligand binding and regulates cell survival, migration, and differentiation, leading to dimerization and intracellular autophosphorylation to create docking sites for downstream signaling molecules. TYRO3/DTK Protein, Human (Biotinylated, sf9, Flag, Avi) is the recombinant human-derived TYRO3, expressed by Sf9 insect cells, with Avi, Flag labeled tag.
Background
The TYRO3/DTK protein is a receptor tyrosine kinase that transmits signals from the extracellular matrix to the cytoplasm by binding to ligands such as TULP1 or GAS6. It regulates various physiological processes including cell survival, migration, and differentiation. When ligands bind to TYRO3 at the cell surface, it leads to dimerization and autophosphorylation of its intracellular domain, creating docking sites for downstream signaling molecules. This activation also interacts with PIK3R1, enhancing PI3-kinase activity and activating the AKT survival pathway. This pathway includes nuclear translocation of NF-kappa-B and up-regulation of NF-kappa-B-regulated genes. TYRO3 signaling is involved in protecting neurons from excitotoxic injury, promoting platelet aggregation, and reorganizing the cytoskeleton. Additionally, TYRO3 plays a crucial role in inhibiting the innate immune response triggered by Toll-like receptors (TLRs) by activating STAT1, which selectively induces the production of suppressors of cytokine signaling SOCS1 and SOCS3. It is also noteworthy that TYRO3 functions as a receptor for lassa virus and lymphocytic choriomeningitis virus, potentially through GAS6 binding to phosphatidyl-serine on the surface of the virion envelope.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-Avi;N-Flag
-
Accession
Q06418 (K453-C890)
-
Gene ID7301
-
Protein Length
Cytoplasmic Domain
-
Conjugation
Biotin
-
Synonyms
TYRO3; BYK; DTK; RSE; SKY; TIF; Tyrosine-protein kinase receptor TYRO3 ; EC 2.7.10.1 ; Tyrosine-protein kinase BYK ; Tyrosine-protein kinase DTK ; Tyrosine-protein kinase RSE ; Tyrosine-protein kinase SKY ; Tyrosine-protein kinase TIF; Tyrosine-Protein Ki
-
AA Sequence
KRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)