TYRO3/DTK Protein, Human (Biotinylated, sf9, Flag, Avi)

TYRO3/DTK protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as TULP1 or GAS6. TYRO3 is activated by ligand binding and regulates cell survival, migration, and differentiation, leading to dimerization and intracellular autophosphorylation to create docking sites for downstream signaling molecules. TYRO3/DTK Protein, Human (Biotinylated, sf9, Flag, Avi) is the recombinant human-derived TYRO3, expressed by Sf9 insect cells, with Avi, Flag labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TYRO3/DTK protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as TULP1 or GAS6. TYRO3 is activated by ligand binding and regulates cell survival, migration, and differentiation, leading to dimerization and intracellular autophosphorylation to create docking sites for downstream signaling molecules. TYRO3/DTK Protein, Human (Biotinylated, sf9, Flag, Avi) is the recombinant human-derived TYRO3, expressed by Sf9 insect cells, with Avi, Flag labeled tag.

Background

The TYRO3/DTK protein is a receptor tyrosine kinase that transmits signals from the extracellular matrix to the cytoplasm by binding to ligands such as TULP1 or GAS6. It regulates various physiological processes including cell survival, migration, and differentiation. When ligands bind to TYRO3 at the cell surface, it leads to dimerization and autophosphorylation of its intracellular domain, creating docking sites for downstream signaling molecules. This activation also interacts with PIK3R1, enhancing PI3-kinase activity and activating the AKT survival pathway. This pathway includes nuclear translocation of NF-kappa-B and up-regulation of NF-kappa-B-regulated genes. TYRO3 signaling is involved in protecting neurons from excitotoxic injury, promoting platelet aggregation, and reorganizing the cytoskeleton. Additionally, TYRO3 plays a crucial role in inhibiting the innate immune response triggered by Toll-like receptors (TLRs) by activating STAT1, which selectively induces the production of suppressors of cytokine signaling SOCS1 and SOCS3. It is also noteworthy that TYRO3 functions as a receptor for lassa virus and lymphocytic choriomeningitis virus, potentially through GAS6 binding to phosphatidyl-serine on the surface of the virion envelope.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-Avi;N-Flag
  • Accession
  • Gene ID
  • Protein Length

    Cytoplasmic Domain

  • Conjugation

    Biotin

  • Synonyms

    TYRO3; BYK; DTK; RSE; SKY; TIF; Tyrosine-protein kinase receptor TYRO3 ; EC 2.7.10.1 ; Tyrosine-protein kinase BYK ; Tyrosine-protein kinase DTK ; Tyrosine-protein kinase RSE ; Tyrosine-protein kinase SKY ; Tyrosine-protein kinase TIF; Tyrosine-Protein Ki

  • AA Sequence

    KRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00