1. Recombinant Proteins
  2. Receptor Proteins Enzymes & Regulators Biotinylated Proteins Kinases
  3. Receptor Tyrosine Kinases Transferases (EC 2) Protein Tyrosine Kinases TK
  4. TAM Receptor Axl
  5. TYRO3
  6. TYRO3/DTK Protein, Human (Biotinylated, sf9, Flag, Avi)

TYRO3/DTK Protein, Human (Biotinylated, sf9, Flag, Avi)

Cat. No.: HY-P702702
Handling Instructions Technical Support

TYRO3/DTK protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as TULP1 or GAS6. TYRO3 is activated by ligand binding and regulates cell survival, migration, and differentiation, leading to dimerization and intracellular autophosphorylation to create docking sites for downstream signaling molecules. TYRO3/DTK Protein, Human (Biotinylated, sf9, Flag, Avi) is the recombinant human-derived TYRO3, expressed by Sf9 insect cells, with Avi, Flag labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TYRO3/DTK protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as TULP1 or GAS6. TYRO3 is activated by ligand binding and regulates cell survival, migration, and differentiation, leading to dimerization and intracellular autophosphorylation to create docking sites for downstream signaling molecules. TYRO3/DTK Protein, Human (Biotinylated, sf9, Flag, Avi) is the recombinant human-derived TYRO3, expressed by Sf9 insect cells, with Avi, Flag labeled tag.

Background

The TYRO3/DTK protein is a receptor tyrosine kinase that transmits signals from the extracellular matrix to the cytoplasm by binding to ligands such as TULP1 or GAS6. It regulates various physiological processes including cell survival, migration, and differentiation. When ligands bind to TYRO3 at the cell surface, it leads to dimerization and autophosphorylation of its intracellular domain, creating docking sites for downstream signaling molecules. This activation also interacts with PIK3R1, enhancing PI3-kinase activity and activating the AKT survival pathway. This pathway includes nuclear translocation of NF-kappa-B and up-regulation of NF-kappa-B-regulated genes. TYRO3 signaling is involved in protecting neurons from excitotoxic injury, promoting platelet aggregation, and reorganizing the cytoskeleton. Additionally, TYRO3 plays a crucial role in inhibiting the innate immune response triggered by Toll-like receptors (TLRs) by activating STAT1, which selectively induces the production of suppressors of cytokine signaling SOCS1 and SOCS3. It is also noteworthy that TYRO3 functions as a receptor for lassa virus and lymphocytic choriomeningitis virus, potentially through GAS6 binding to phosphatidyl-serine on the surface of the virion envelope.

Species

Human

Source

Sf9 insect cells

Tag

N-Avi;N-Flag

Accession

Q06418 (K453-C890)

Gene ID

7301

Protein Length

Cytoplasmic Domain

Conjugation

Biotin

Synonyms
TYRO3; TYRO3 protein tyrosine kinase; RSE; tyrosine-protein kinase receptor TYRO3; Brt; Dtk; Sky; Tif; tyrosine-protein kinase DTK; tyrosine-protein kinase RSE; tyrosine-protein kinase SKY; tyrosine-protein kinase byk; BYK; FLJ16467
AA Sequence

KRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TYRO3/DTK Protein, Human (Biotinylated, sf9, Flag, Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TYRO3/DTK Protein, Human (Biotinylated, sf9, Flag, Avi)
Cat. No.:
HY-P702702
Quantity:
MCE Japan Authorized Agent: