UBE2J2 Protein, Human (GST)

Customer Review

Based on 1 Customer Validation

The UBE2J2 protein plays a crucial role in cellular processes by catalyzing the covalent attachment of ubiquitin to other proteins. Its function is involved in the selective degradation of misfolded membrane proteins extending into the endoplasmic reticulum (ERAD), as suggested by the similarity of related processes. UBE2J2 Protein, Human (GST) is the recombinant human-derived UBE2J2 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The UBE2J2 protein plays a crucial role in cellular processes by catalyzing the covalent attachment of ubiquitin to other proteins. Its function is involved in the selective degradation of misfolded membrane proteins extending into the endoplasmic reticulum (ERAD), as suggested by the similarity of related processes. UBE2J2 Protein, Human (GST) is the recombinant human-derived UBE2J2 protein, expressed by E. coli , with N-GST labeled tag.

Background

UBE2J2, or ubiquitin-conjugating enzyme E2 J2, is a protein that plays a central role in the covalent attachment of ubiquitin to other proteins, a process critical for the regulation of protein stability and degradation. UBE2J2 is suggested to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD), indicating its involvement in cellular quality control mechanisms. Additionally, in cooperation with the GATOR2 complex, UBE2J2 catalyzes 'Lys-6'-linked ubiquitination of NPRL2, suggesting its participation in the regulation of cellular processes through ubiquitin modification. It has to highlight UBE2J2's dual role in ERAD and the ubiquitination of specific targets, illustrating its versatility in participating in diverse cellular pathways.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • UBE2J2 (E124-R224)
      Accession # Q8N2K1-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    UBE2J2; Ubiquitin Conjugating Enzyme E2 J2; NCUBE2; Non-Canonical Ubiquitin-Conjugating Enzyme 2; Ubiquitin-Conjugating Enzyme E2 J2; Ubiquitin-Conjugating Enzyme E2, J2 (UBC6 Homolog,Yeast); E2 Ubiquitin-Conjugating Enzyme J2; NCUBE-2; Ubc6p; Ubiquitin-C

  • AA Sequence

    EKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANR

  • Predicted Molecular Mass

    38 kDa

  • Molecular Weight

    Approximately 30 kDa & 36 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 8% trehalose, 0.02% Tween 20, 1 mM DTT, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00