UBE2J2 Protein, Human (GST)
Based on 1 Customer Validation
The UBE2J2 protein plays a crucial role in cellular processes by catalyzing the covalent attachment of ubiquitin to other proteins. Its function is involved in the selective degradation of misfolded membrane proteins extending into the endoplasmic reticulum (ERAD), as suggested by the similarity of related processes. UBE2J2 Protein, Human (GST) is the recombinant human-derived UBE2J2 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The UBE2J2 protein plays a crucial role in cellular processes by catalyzing the covalent attachment of ubiquitin to other proteins. Its function is involved in the selective degradation of misfolded membrane proteins extending into the endoplasmic reticulum (ERAD), as suggested by the similarity of related processes. UBE2J2 Protein, Human (GST) is the recombinant human-derived UBE2J2 protein, expressed by E. coli , with N-GST labeled tag.
UBE2J2, or ubiquitin-conjugating enzyme E2 J2, is a protein that plays a central role in the covalent attachment of ubiquitin to other proteins, a process critical for the regulation of protein stability and degradation. UBE2J2 is suggested to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD), indicating its involvement in cellular quality control mechanisms. Additionally, in cooperation with the GATOR2 complex, UBE2J2 catalyzes 'Lys-6'-linked ubiquitination of NPRL2, suggesting its participation in the regulation of cellular processes through ubiquitin modification. It has to highlight UBE2J2's dual role in ERAD and the ubiquitination of specific targets, illustrating its versatility in participating in diverse cellular pathways.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q8N2K1-1 (E124-R224)
-
Molecular Construction
-
N-term
-
GST
-
UBE2J2 (E124-R224)
Accession # Q8N2K1-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
UBE2J2; Ubiquitin Conjugating Enzyme E2 J2; NCUBE2; Non‑Canonical Ubiquitin‑Conjugating Enzyme 2; Ubiquitin‑Conjugating Enzyme E2 J2; Ubiquitin‑Conjugating Enzyme E2, J2 (UBC6 Homolog,Yeast); E2 Ubiquitin‑Conjugating Enzyme J2; NCUBE‑2; Ubc6p; Ubiquitin‑C
-
AA Sequence
EKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANR
-
Predicted Molecular Mass
38 kDa
-
Molecular Weight
Approximately 30 kDa & 36 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of 20 mM PB, 8% trehalose, 0.02% Tween 20, 1 mM DTT, pH 7.0.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
