UBE2V2 Protein, Human (sf9)
UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human (sf9) is the recombinant human-derived UBE2V2 protein, expressed by Sf9 insect cells, with tag free.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human (sf9) is the recombinant human-derived UBE2V2 protein, expressed by Sf9 insect cells, with tag free.
Background
The UBE2V2 protein lacks ubiquitin ligase activity when acting alone, but forms a functional heterodimer with UBE2N to catalyze the synthesis of non-canonical poly-ubiquitin chains linked through 'Lys-63'. Notably, this type of poly-ubiquitination does not result in protein degradation by the proteasome. UBE2V2 plays a pivotal role in mediating the transcriptional activation of target genes, exerting influence over cell cycle progression, and contributing to cellular differentiation. Furthermore, it is involved in the error-free DNA repair pathway, enhancing cell survival following DNA damage. UBE2V2 primarily functions as a heterodimer with UBE2N and demonstrates binding affinity for CHFR, suggesting its involvement in various cellular processes and molecular interactions.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q15819 (M1-N145)
-
Gene ID7336
-
Molecular Construction
-
N-term
-
UBE2V2 (M1-N145)
Accession # Q15819 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2V2; Ubiquitin Conjugating Enzyme E2 V2; Ubiquitin-Conjugating Enzyme E2 Variant 2; EDPF-1; EDAF-1; MMS2; UEV2; DDVit-1; DDVIT1; UEV-2; EDPF1; Enterocyte Differentiation-Associated Factor 1; Enterocyte Differentiation-Promoting Factor 1; Vitamin D3-Inducible Protein; MMS2 Homolog; DDVit 1; CDNA,FLJ93989,Homo Sapiens Ubiquitin-Conjugating Enzyme E2 Variant 2 (UBE2V2),MRNA; Methyl Methanesulfonate Sensitive 2,S.Cerevisiae,Homolog Of; Ubiquitin-Conjugating Enzyme E2 Variant 2,Isoform CRA_a; Enterocyte Differentiation-Associated Factor EDAF-1; Enterocyte Differentiation Promoting Factor 1 Alpha,25-Dihydroxyvitamin D3-Inducible
-
AA Sequence
MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
-
Predicted Molecular Mass
16 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
