UBE2Z Protein, Human (His)
UBE2Z Protein, a catalyst in ubiquitin conjugation, facilitates the covalent attachment of ubiquitin to target proteins. It serves as a specific substrate for UBA6 and is implicated in the regulation of apoptosis. UBE2Z Protein, Human (His) is the recombinant human-derived UBE2Z protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
UBE2Z Protein, a catalyst in ubiquitin conjugation, facilitates the covalent attachment of ubiquitin to target proteins. It serves as a specific substrate for UBA6 and is implicated in the regulation of apoptosis. UBE2Z Protein, Human (His) is the recombinant human-derived UBE2Z protein, expressed by E. coli , with N-6*His labeled tag.
Background
UBE2Z protein serves as an enzyme that catalyzes the covalent attachment of ubiquitin to other proteins, operating as a substrate specifically for UBA6 and not charged with ubiquitin by UBE1. This implies its involvement in the intricate process of apoptosis regulation, underscoring its role in the ubiquitin-mediated modification of target proteins.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9H832-2 (M1-V246)
-
Molecular Construction
-
N-term
-
6*His
-
UBE2Z (M1-V246)
Accession # Q9H832-2 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
UBE2Z; Ubiquitin Conjugating Enzyme E2 Z; Ubiquitin-Conjugating Enzyme E2 Z; E2 Ubiquitin-Conjugating Enzyme Z; Ubiquitin Carrier Protein Z; Ubiquitin-Protein Ligase Z; USE1; Uba6-Specific E2 Conjugating Enzyme 1; UBA6-Specific Enzyme E2; FLJ13855; Ubiqui
-
AA Sequence
MSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
-
Predicted Molecular Mass
30.2 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
