UCHL3 Protein, Mouse (His, solution)
Based on 1 Customer Validation
UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is involved in the regulation of cellular processes and protein degradation. It is particularly expressed in the testes and plays a vital role in spermatogenesis. UCHL3 Protein's significance in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Mouse (His, solution) is the recombinant mouse-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is involved in the regulation of cellular processes and protein degradation. It is particularly expressed in the testes and plays a vital role in spermatogenesis. UCHL3 Protein's significance in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Mouse (His, solution) is the recombinant mouse-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.
Background
UCHL3 Protein is a deubiquitinating enzyme (DUB) that plays a crucial role in controlling the levels of cellular ubiquitin by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, it specifically recognizes and hydrolyzes the peptide bond at the C-terminal glycine of ubiquitin or NEDD8. UCHL3 Protein exhibits a preference for 'Lys-48'-linked ubiquitin chains and has a 10-fold preference for Arg and Lys at position P3''. Its deubiquitinating activity includes the deubiquitination of ENAC in apical compartments, regulating the recycling of the apical membrane. Additionally, UCHL3 Protein indirectly enhances the phosphorylation of IGFIR, AKT, and FOXO1, thereby promoting insulin signaling and insulin-induced adipogenesis. It is also essential for stress-response retinal, skeletal muscle, and germ cell maintenance. Furthermore, UCHL3 Protein may be involved in working memory and can hydrolyze UBB(+1), a mutated form of ubiquitin that is resistant to degradation by the proteasome.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His
-
Accession
Q9JKB1 (E2-A230)
-
Gene ID50933
-
Molecular Construction
-
N-term
-
His
-
UCHL3 (E2-A230)
Accession # Q9JKB1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UCHL3; Ubiquitin C-Terminal Hydrolase L3; Ubiquitin Carboxyl-Terminal Esterase L3 (Ubiquitin Thiolesterase); Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L3; Ubiquitin Thioesterase L3; Ubiquitin Thiolesterase; UCH-L3; Ubiquitin Carboxyl-Terminal Hydrolas
-
AA Sequence
EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
-
Predicted Molecular Mass
26 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 20% glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
