ULBP1/RAET1I Protein, Human (Biotinylated, HEK293, mFc-Avi)

Customer Review

Based on 1 Customer Validation

The ULBP1/RAET1I protein is critical in the cytotoxicity of natural killer cells and can bind to and activate the KLRK1/NKG2D receptor. This mechanism highlights the importance of ULBP1/RAET1I in mediating cytotoxic responses. ULBP1/RAET1I Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ULBP1 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The ULBP1/RAET1I protein is critical in the cytotoxicity of natural killer cells and can bind to and activate the KLRK1/NKG2D receptor. This mechanism highlights the importance of ULBP1/RAET1I in mediating cytotoxic responses. ULBP1/RAET1I Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ULBP1 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

Background

The ULBP1/RAET1I protein plays a crucial role in natural killer cell cytotoxicity by acting as a ligand that binds to and activates the KLRK1/NKG2D receptor. This binding and activation mechanism highlights the significance of ULBP1/RAET1I in mediating the cytotoxic responses of natural killer cells. Moreover, it is noteworthy that ULBP1/RAET1I does not exhibit binding to beta2-microglobulin. This characteristic interaction profile underscores the specificity and selectivity of ULBP1/RAET1I in its engagement with KLRK1/NKG2D, emphasizing its pivotal role in immune responses and its potential as a therapeutic target for modulating natural killer cell activity.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/mL can bind human Biotinylated ULBP1, the EC50 is <8 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-mFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ULBP1 (G26-G216)
      Accession # Q9BZM6
    • mFc-Avi
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Conjugation

    Biotin

  • Conjugate Method

    The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

  • Synonyms

    Ulbp1; UL16 binding protein 1; N2DL1; ALCAN-Beta; Alcan-Beta; N2DL-1; NKG2DL1; NKG2D Ligand 1; UL16-Binding Protein 1; Retinoic Acid Early Transcript 1I ; RAET1I

  • AA Sequence

    GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

  • Predicted Molecular Mass

    51.3 kDa

  • Molecular Weight

    Approximately 55 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00