Copy Link Print Information

ULBP3 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The ULBP3 protein plays a key role in natural killer cell cytotoxicity and activates the KLRK1/NKG2D receptor. The interaction of ULBP3 highlights its importance in mediating cytotoxic responses. ULBP3 Protein, Human (HEK293, His) is the recombinant human-derived ULBP3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for ULBP3 Protein, Human (HEK293, His)
  • Experimental Validation Results for ULBP3 Protein, Human (HEK293, His)
  • ULBP3 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The ULBP3 protein plays a key role in natural killer cell cytotoxicity and activates the KLRK1/NKG2D receptor. The interaction of ULBP3 highlights its importance in mediating cytotoxic responses. ULBP3 Protein, Human (HEK293, His) is the recombinant human-derived ULBP3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The ULBP3 protein plays a pivotal role in natural killer cell cytotoxicity by functioning as a ligand that binds to and activates the KLRK1/NKG2D receptor. ULBP3 mediates the cytotoxic responses of natural killer cells. Through its binding affinity with KLRK1/NKG2D, ULBP3 facilitates the activation of this receptor, contributing to the recognition and targeting of cells marked for elimination. Importantly, ULBP3 does not exhibit binding to beta2-microglobulin, as indicated by similarities in its interaction profile. This insight into the binding characteristics of ULBP3 further delineates its role as a key player in immune responses, specifically in the orchestration of natural killer cell activity.

Verified Bioactivity

Measured by its binding ability in a functional ELISA.When Recombinant Human NKG2D/CD314 (HY-P70688) is immobilized at 2 μg/mL (100 μL/well) can bind Recombinant Human ULBP-3. The ED50 for this effect is 1.127 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA.When Recombinant Human NKG2D/CD314 (HY-P70688) is immobilized at 2 μg/mL (100 μL/well) can bind Recombinant Human ULBP-3. The ED50 for this effect is 1.127 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9BZM4/NP_078794 (D30-P216)

  • Gene ID
    79465
  • Molecular Construction
    • N-term
    • ULBP3 (D30-P216)
      Accession # Q9BZM4/NP_078794
    • 6*His
    • C-term
  • Protein Length

    Full Length of UL16-binding protein 3 Chain

  • Synonyms

    ULBP3; UL16 Binding Protein 3; RAET1N; Retinoic Acid Early Transcript 1N; UL16-Binding Protein 3; NKG2D Ligand 3; ALCAN-Gamma; NKG2DL3; N2DL-3; N2DL3

  • AA Sequence

    DAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAP

  • Predicted Molecular Mass

    22 kDa

  • Molecular Weight

    Approximately 25-31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.2, 8% trehalose.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA.When Recombinant Human NKG2D/CD314 (HY-P70688) is immobilized at 2 μg/mL (100 μL/well) can bind Recombinant Human ULBP-3. The ED50 for this effect is 1.127 μg/mL.

  • ULBP3 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for ULBP3 Protein, Human (HEK293, His)
  • Experimental Validation Results for ULBP3 Protein, Human (HEK293, His)
  • ULBP3 Protein, Human (HEK293, His) Product Image