NKG2D/CD314 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance, binding to multiple stress-inducing ligands on tumor and virus-infected cells.It plays a dual role by stimulating NK cells and enhancing T cell activation in CD8(+) T cell-mediated adaptive responses.NKG2D/CD314 Protein, Human (HEK293, His) is the recombinant human-derived NKG2D/CD314 protein, expressed by HEK293 , with N-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance, binding to multiple stress-inducing ligands on tumor and virus-infected cells.It plays a dual role by stimulating NK cells and enhancing T cell activation in CD8(+) T cell-mediated adaptive responses.NKG2D/CD314 Protein, Human (HEK293, His) is the recombinant human-derived NKG2D/CD314 protein, expressed by HEK293 , with N-6*His labeled tag.
Background
NKG2D/CD314 protein operates as an activating and costimulatory receptor essential for immunosurveillance, binding to diverse cellular stress-inducible ligands presented on autologous tumor cells and virus-infected cells. It plays a dual role in innate immune responses, stimulating both activating killer (NK) cells and acting as a costimulatory receptor for T-cell receptors (TCR) in CD8(+) T-cell-mediated adaptive immune responses, enhancing T-cell activation. The receptor facilitates perforin-mediated elimination of ligand-expressing tumor cells, and its signaling cascades involve calcium influx, ultimately leading to TNF-alpha expression. Additionally, NKG2D/CD314 participates in NK cell-mediated bone marrow graft rejection and may regulate the differentiation and survival of NK cells. Its ligand-binding capacity extends to various subfamilies of MHC class I-related glycoproteins, including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3), and ULBP4. The protein forms homodimers through disulfide linkage and heterohexamers with HCST/DAP10 subunits, a crucial interaction for NK cell surface expression and cytotoxicity induction. Furthermore, it can establish disulfide-bonded heterodimers with CD94 and interacts with CEACAM1, recruiting PTPN6 for VAV1 dephosphorylation, while not interacting with TYROBP.
Verified Bioactivity
1.Immobilized Recombinant Human MICA (C-Fc) at 10 μg/mL (100 μL/well) can bind Recombinant Human NKG2D (N-6His).The ED50 of Recombinant Human NKG2D (N-6His) is 1.0-10.0 ug/mL.
2.Immobilized Recombinant Human NKG2D-His at 2 μg/mL (100 μL/well) can bind Recombinant Human MICA (C-Fc).The ED50 of Recombinant Human MICA (C-Fc) is 10.0-20.0 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-6*His
-
Accession
P26718 (F78-V216)
-
Molecular Construction
-
N-term
-
6*His
-
NKG2D (F78-V216)
Accession # P26718 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
KLRK1; CD314; Prev. D12S2489E; Killer Cell Lectin-Like Receptor Subfamily K, Member 1; NKG2D; NKG2-D-Activating NK Receptor; NKG2-D Type II Integral Membrane Protein; DNA Segment On Chromosome 12 (Unique) 2489 Expressed Sequence; NK Cell Receptor D; Killer Cell Lectin-Like Receptor Subfamily K Member 1; NKG2-D; CD314 Antigen; Killer Cell Lectin Like Receptor K1; KLR
-
AA Sequence
FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
-
Predicted Molecular Mass
16.9 kDa
-
Molecular Weight
Approximately 20-33 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)