UNC5B Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
UNC5B is an important netrin receptor that mediates axonal repulsion during nervous system development and binds to DCC to trigger signaling pathways. It negatively regulates vascular branching in angiogenesis, inducing tip cell filopodia retraction. UNC5B Protein, Human (HEK293, hFc) is the recombinant human-derived UNC5B protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
UNC5B is an important netrin receptor that mediates axonal repulsion during nervous system development and binds to DCC to trigger signaling pathways. It negatively regulates vascular branching in angiogenesis, inducing tip cell filopodia retraction. UNC5B Protein, Human (HEK293, hFc) is the recombinant human-derived UNC5B protein, expressed by HEK293 , with C-hFc labeled tag.
UNC5B, a crucial receptor for netrin, emerges as a key player in axon guidance, primarily mediating axon repulsion in neuronal growth cones during the development of the nervous system upon ligand binding. This repulsive effect is suggested to be orchestrated by its association with DCC, potentially triggering signaling pathways leading to axon repulsion. Beyond its role in neural development, UNC5B operates as a netrin receptor with negative regulatory impact on vascular branching during angiogenesis, facilitating the retraction of tip cell filopodia on endothelial growth cones in response to netrin. Notably, UNC5B also functions as a dependence receptor, inducing apoptosis when not engaged with the netrin ligand, a process that involves the activation of DAPK1. In the absence of netrin, UNC5B activates DAPK1 by reducing its autoinhibitory phosphorylation, thereby enhancing its catalytic activity. The receptor engages in diverse protein interactions, including the cytoplasmic part of DCC, GNAI2, FLRT3, FLRT2, and FLRT3 in a context-dependent manner, underlining its multifaceted role in axon guidance, angiogenesis regulation, and apoptotic signaling.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q8IZJ1-1 (G27-P363)
-
Molecular Construction
-
N-term
-
UNC5B (G27-P363)
Accession # Q8IZJ1-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
UNC5B; Unc‑5 Netrin Receptor B; P53RDL1; UNC5H2; P53‑Regulated Receptor For Death And Life Protein 1; Protein Unc‑5 Homolog 2; Protein Unc‑5 Homolog B; Netrin Receptor UNC5B; Transmembrane Receptor Unc5H2; Unc‑5 Homolog B (C. Elegans); Unc5 (C.Elegans Hom
-
AA Sequence
GTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTLSDP
-
Predicted Molecular Mass
64.8 kDa
-
Molecular Weight
Approximately 66-70 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4, 5% Trehalose, 5% Mannitol, 0.01% Tween-80.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)