UNC5B Protein, Human (HEK293, hFc)

Customer Review

Based on 1 Customer Validation

UNC5B is an important netrin receptor that mediates axonal repulsion during nervous system development and binds to DCC to trigger signaling pathways. It negatively regulates vascular branching in angiogenesis, inducing tip cell filopodia retraction. UNC5B Protein, Human (HEK293, hFc) is the recombinant human-derived UNC5B protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

UNC5B is an important netrin receptor that mediates axonal repulsion during nervous system development and binds to DCC to trigger signaling pathways. It negatively regulates vascular branching in angiogenesis, inducing tip cell filopodia retraction. UNC5B Protein, Human (HEK293, hFc) is the recombinant human-derived UNC5B protein, expressed by HEK293 , with C-hFc labeled tag.

Background

UNC5B, a crucial receptor for netrin, emerges as a key player in axon guidance, primarily mediating axon repulsion in neuronal growth cones during the development of the nervous system upon ligand binding. This repulsive effect is suggested to be orchestrated by its association with DCC, potentially triggering signaling pathways leading to axon repulsion. Beyond its role in neural development, UNC5B operates as a netrin receptor with negative regulatory impact on vascular branching during angiogenesis, facilitating the retraction of tip cell filopodia on endothelial growth cones in response to netrin. Notably, UNC5B also functions as a dependence receptor, inducing apoptosis when not engaged with the netrin ligand, a process that involves the activation of DAPK1. In the absence of netrin, UNC5B activates DAPK1 by reducing its autoinhibitory phosphorylation, thereby enhancing its catalytic activity. The receptor engages in diverse protein interactions, including the cytoplasmic part of DCC, GNAI2, FLRT3, FLRT2, and FLRT3 in a context-dependent manner, underlining its multifaceted role in axon guidance, angiogenesis regulation, and apoptotic signaling.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • UNC5B (G27-P363)
      Accession # Q8IZJ1-1
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    UNC5B; Unc-5 Netrin Receptor B; P53RDL1; UNC5H2; P53-Regulated Receptor For Death And Life Protein 1; Protein Unc-5 Homolog 2; Protein Unc-5 Homolog B; Netrin Receptor UNC5B; Transmembrane Receptor Unc5H2; Unc-5 Homolog B (C. Elegans); Unc5 (C.Elegans Hom

  • AA Sequence

    GTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTLSDP

  • Predicted Molecular Mass

    64.8 kDa

  • Molecular Weight

    Approximately 66-70 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4, 5% Trehalose, 5% Mannitol, 0.01% Tween-80.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00