1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Endothelial cell CD Proteins
  4. U-PAR/CD87
  5. uPAR Protein, Mouse (HEK293, His)

The uPAR protein acts as a receptor for urokinase plasminogen activator, facilitating plasmin formation and signal transduction activation.It interacts with SRPX2 and forms a monomer.uPAR also interacts with MRC2 and SORL1, reducing PLAUR internalization.Additionally, the PLAUR-PLAU-SERPINE1 complex interacts with SORL1.uPAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived uPAR protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The uPAR protein acts as a receptor for urokinase plasminogen activator, facilitating plasmin formation and signal transduction activation.It interacts with SRPX2 and forms a monomer.uPAR also interacts with MRC2 and SORL1, reducing PLAUR internalization.Additionally, the PLAUR-PLAU-SERPINE1 complex interacts with SORL1.uPAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived uPAR protein, expressed by HEK293 , with C-His labeled tag.

Background

The uPAR protein functions as a receptor for urokinase plasminogen activator and plays a crucial role in localizing and facilitating the formation of plasmin. Additionally, it mediates signal transduction activation effects of U-PA independently of proteolysis. It is predominantly found as a monomer and interacts with SRPX2 through its UPAR/Ly6 domains. uPAR also interacts with MRC2 and SORL1, with the latter interaction reducing PLAUR internalization. Moreover, the ternary complex consisting of PLAUR-PLAU-SERPINE1 also interacts with SORL1.

Biological Activity

Recombinant Mouse PLAUR / CD87 / uPAR Protein (His Tag) immobilized on CM5 chip, can bind Recombinant Human Urokinase / PLAU Protein (His Tag) with an affinity constant of 9.79 nM as determined in an SPR assay (Biacore 8K).

Species

Mouse

Source

HEK293

Tag

C-His

Accession

P35456-1/NP_035243.1 (L24-T297)

Gene ID
Molecular Construction
N-term
uPAR (L24-T297)
Accession # P35456-1/NP_035243.1
His
C-term
Protein Length

Partial

Synonyms
Urokinase plasminogen activator surface receptor; U-PAR; CD87; PLAUR; MO3
AA Sequence

LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPT

Predicted Molecular Mass
31.4 kDa
Molecular Weight

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween-80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

uPAR Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

uPAR Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
uPAR Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77276
Quantity:
MCE Japan Authorized Agent: