Copy Link Print Information

uPAR Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The uPAR protein acts as a receptor for urokinase plasminogen activator, facilitating plasmin formation and signal transduction activation.It interacts with SRPX2 and forms a monomer.uPAR also interacts with MRC2 and SORL1, reducing PLAUR internalization.Additionally, the PLAUR-PLAU-SERPINE1 complex interacts with SORL1.uPAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived uPAR protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • uPAR Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The uPAR protein acts as a receptor for urokinase plasminogen activator, facilitating plasmin formation and signal transduction activation.It interacts with SRPX2 and forms a monomer.uPAR also interacts with MRC2 and SORL1, reducing PLAUR internalization.Additionally, the PLAUR-PLAU-SERPINE1 complex interacts with SORL1.uPAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived uPAR protein, expressed by HEK293 , with C-His labeled tag.

Background

The uPAR protein functions as a receptor for urokinase plasminogen activator and plays a crucial role in localizing and facilitating the formation of plasmin. Additionally, it mediates signal transduction activation effects of U-PA independently of proteolysis. It is predominantly found as a monomer and interacts with SRPX2 through its UPAR/Ly6 domains. uPAR also interacts with MRC2 and SORL1, with the latter interaction reducing PLAUR internalization. Moreover, the ternary complex consisting of PLAUR-PLAU-SERPINE1 also interacts with SORL1.

Verified Bioactivity

Recombinant Mouse PLAUR / CD87 / uPAR Protein (His Tag) immobilized on CM5 chip, can bind Recombinant Human Urokinase / PLAU Protein (His Tag) with an affinity constant of 9.79 nM as determined in an SPR assay (Biacore 8K).

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    P35456-1/NP_035243.1 (L24-T297)

  • Gene ID
    18793  [NCBI]
  • Molecular Construction
    • N-term
    • uPAR (L24-T297)
      Accession # P35456-1/NP_035243.1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PLAUR; Monocyte Activation Antigen Mo3; Plasminogen Activator, Urokinase Receptor; U-PAR; Urokinase Plasminogen Activator Surface Receptor; Urokinase Plasminogen Activator Receptor; UPAR; U-Plasminogen Activator Receptor Form 2; URKR; CD87 Antigen; CD87;

  • AA Sequence

    LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPT

  • Predicted Molecular Mass

    31.4 kDa

  • Molecular Weight

    Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween-80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • uPAR Protein, Mouse (HEK293, His) Product Image
    1/16
  • uPAR Protein, Mouse (HEK293, His) Product Image