uPAR Protein, Cynomolgus (HEK293, His)

uPAR protein is the receptor of urokinase plasminogen activator and plays an important role in localizing and promoting the formation of plasmin. It mediates proteolysis-independent signal transduction through U-PA and is regulated through negative feedback. uPAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived uPAR protein, expressed by HEK293 , with C-His labeled tag.

uPAR Protein serves as a receptor for urokinase plasminogen activator, playing a crucial role in localizing and facilitating plasmin formation. Additionally, it mediates the proteolysis-independent signal transduction activation effects of U-PA. Subject to negative-feedback regulation by U-PA, uPAR undergoes cleavage into an inactive form. It typically exists as a monomer, and interacts with various proteins, including SRPX2 and MRC2. Notably, it forms a complex with FAP (seprase) at the cell surface of invadopodia membrane, contributing to cellular processes involved in proteolysis and signaling. Moreover, uPAR engages in a ternary complex with PLAU (urokinase-type plasminogen activator) and SERPINE1, and this complex also interacts with SORL1, further highlighting its multifaceted interactions in cellular functions.

Immobilized Cynomolgus uPAR, His Tag at 2 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Human PLAU, His Tag with the EC₅₀ of 15.3 ng/mL determined by ELISA.

Cynomolgus

HEK293

C-8*His

Q9GK78 (L23-G305)

102139334  [NCBI]

Partial

LRCMQCKSNGDCRVEECALGQDLCRTTIVRMWEEGEELELVEKSCTHSEKTNRTMSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTFSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPSCPGSSGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGHQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTYEPKNQSYMVRGCVTASMCQRAHLGDAFSMHHINVSCCTESGCNHPDLDIQYRKG

Approximately 60-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.