uPAR Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
uPAR protein is the receptor of urokinase plasminogen activator and plays an important role in localizing and promoting the formation of plasmin. It mediates proteolysis-independent signal transduction through U-PA and is regulated through negative feedback. uPAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived uPAR protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
uPAR protein is the receptor of urokinase plasminogen activator and plays an important role in localizing and promoting the formation of plasmin. It mediates proteolysis-independent signal transduction through U-PA and is regulated through negative feedback. uPAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived uPAR protein, expressed by HEK293 , with C-His labeled tag.
Background
uPAR Protein serves as a receptor for urokinase plasminogen activator, playing a crucial role in localizing and facilitating plasmin formation. Additionally, it mediates the proteolysis-independent signal transduction activation effects of U-PA. Subject to negative-feedback regulation by U-PA, uPAR undergoes cleavage into an inactive form. It typically exists as a monomer, and interacts with various proteins, including SRPX2 and MRC2. Notably, it forms a complex with FAP (seprase) at the cell surface of invadopodia membrane, contributing to cellular processes involved in proteolysis and signaling. Moreover, uPAR engages in a ternary complex with PLAU (urokinase-type plasminogen activator) and SERPINE1, and this complex also interacts with SORL1, further highlighting its multifaceted interactions in cellular functions.
Verified Bioactivity
Immobilized Cynomolgus uPAR, His Tag at 2 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Human PLAU, His Tag with the EC50 of 15.3 ng/mL determined by ELISA.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
Q9GK78 (L23-G305)
-
Molecular Construction
-
N-term
-
uPAR (L23-G305)
Accession # Q9GK78 -
8*His
-
C-term
-
-
Protein Length
Full Length of Urokinase plasminogen activator surface receptor Chain
-
Synonyms
PLAUR; Monocyte Activation Antigen Mo3; Plasminogen Activator, Urokinase Receptor; U-PAR; Urokinase Plasminogen Activator Surface Receptor; Urokinase Plasminogen Activator Receptor; UPAR; U-Plasminogen Activator Receptor Form 2; URKR; CD87 Antigen; CD87;
-
AA Sequence
LRCMQCKSNGDCRVEECALGQDLCRTTIVRMWEEGEELELVEKSCTHSEKTNRTMSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTFSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPSCPGSSGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGHQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTYEPKNQSYMVRGCVTASMCQRAHLGDAFSMHHINVSCCTESGCNHPDLDIQYRKG
-
Predicted Molecular Mass
32.7 kDa
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
