USP14 Protein, Human
Based on 1 Customer Validation
USP14 is a proteasome-associated deubiquitinase that regulates ubiquitin dynamics by releasing ubiquitin from proteins marked for degradation. As a reversible proteasome subunit, USP14 ensures ubiquitin replenishment. USP14 Protein, Human is the recombinant human-derived USP14 protein, expressed by E. coli, with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
USP14 is a proteasome-associated deubiquitinase that regulates ubiquitin dynamics by releasing ubiquitin from proteins marked for degradation. As a reversible proteasome subunit, USP14 ensures ubiquitin replenishment. USP14 Protein, Human is the recombinant human-derived USP14 protein, expressed by E. coli, with tag free.
Background
USP14, a proteasome-associated deubiquitinase, emerges as a crucial player in cellular processes, particularly in the dynamic regulation of ubiquitin at the proteasome. Functioning as a reversibly associated subunit of the proteasome, USP14 ensures the release of ubiquitin from ubiquitinated proteins targeted for degradation, facilitating the regeneration of ubiquitin within the cellular environment. Beyond its role in proteasome-mediated protein turnover, USP14 plays a pivotal role in diverse physiological contexts. It is involved in the degradation of the chemokine receptor CXCR4, a critical event for CXCL12-induced cell chemotaxis. Additionally, USP14 serves as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under non-stressed conditions, interacting with ERN1 and modulating the degradation of unfolded endoplasmic reticulum proteins. Furthermore, USP14 contributes to synaptic development and function at neuromuscular junctions (NMJs) and participates in the innate immune defense against viruses by stabilizing the viral DNA sensor CGAS, thereby impeding its autophagic degradation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P54578-1 (Q96-Q494)
-
Gene ID9097
-
Protein Length
Partial
-
Synonyms
USP14; Ubiquitin Specific Peptidase 14; TGT; Ubp6; Ubiquitin Specific Peptidase 14 (TRNA-Guanine Transglycosylase); Ubiquitin Specific Protease 14 (TRNA-Guanine Transglycosylase); Ubiquitin Carboxyl-Terminal Hydrolase 14; Deubiquitinating Enzyme 14; Ubiqu
-
AA Sequence
QLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
-
Predicted Molecular Mass
45.6 kDa
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT
.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
