USP8 Protein, Human (sf9, His, GST)

USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9, His, GST) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with N-His and N-GST labeled tag.

USP8, a hydrolase with pivotal roles in cellular regulation, serves as a crucial player in protein turnover by effectively removing conjugated ubiquitin from proteins, preventing their degradation. This enzymatic action extends to both 'Lys-48' and 'Lys-63'-linked ubiquitin chains, showcasing its versatility in modulating ubiquitin dynamics. USP8's catalytic activity is notably enhanced during the M phase, underlining its cell cycle-dependent regulatory functions. The enzyme is intricately involved in various cellular processes, including cell proliferation and the response to serum stimulation, where it is required for S phase entry. Additionally, USP8 is implicated in the modulation of T-cell anergy, stabilization of proteins such as STAM2 and RASGRF1, and regulation of endosomal dynamics, cargo sorting, and membrane traffic. Its role in controlling ubiquitination on endosomes is essential for maintaining the organelle's morphology. USP8 further exerts influence on diverse pathways, including acrosome biogenesis, EGFR degradation, MAPK signaling, and the modulation of BACE1-mediated APP cleavage and amyloid-beta formation. The multifaceted functions of USP8 highlight its significance in maintaining cellular homeostasis and orchestrating various signaling cascades.

Human

Sf9 insect cells

N-His;N-GST

P40818-1 (P734-G1110)

9101

Partial

PTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50mM Tris-HCl (pH 7.5), 200mM NaCl, 5% glycerol, 1mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.