Wee1 Protein, Human (sf9, His)

Customer Review

Based on 1 Customer Validation

Wee1 Protein acts as a crucial negative regulator of the G2 to M transition, ensuring nuclear protection by phosphorylating CDK1 on 'Tyr-15' and inactivating the cyclin B1-CDK1 complex. Its peak activity in G2 phase decreases as cells progress into M phase, with dynamic regulation, increased phosphorylation during S and G2 phases, and diminished levels during M/G1 phase transition potentially due to degradation. Wee1 Protein, Human (sf9, His) is the recombinant human-derived Wee1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Wee1 Protein acts as a crucial negative regulator of the G2 to M transition, ensuring nuclear protection by phosphorylating CDK1 on 'Tyr-15' and inactivating the cyclin B1-CDK1 complex. Its peak activity in G2 phase decreases as cells progress into M phase, with dynamic regulation, increased phosphorylation during S and G2 phases, and diminished levels during M/G1 phase transition potentially due to degradation. Wee1 Protein, Human (sf9, His) is the recombinant human-derived Wee1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Background

Wee1 Protein functions as a critical negative regulator of the G2 to M transition, preventing entry into mitosis by safeguarding the nucleus from the activation of cytoplasmically bound cyclin B1-complexed CDK1. Through the phosphorylation of CDK1 on 'Tyr-15,' Wee1 specifically targets and inactivates the cyclin B1-CDK1 complex, with its activity peaking during the G2 phase and reaching a minimum as cells progress into M phase. Notably, Wee1's phosphorylation of cyclin B1-CDK1 occurs exclusively on 'Tyr-15,' while monomeric CDK1 remains unphosphorylated. Its activity undergoes dynamic regulation, increasing during S and G2 phases and diminishing at M phase, accompanied by hyperphosphorylation. Additionally, a correlated reduction in Wee1 protein levels occurs during the M/G1 phase transition, potentially attributed to its degradation.

Verified Bioactivity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • Wee1 (M291-K575)
      Accession # P30291-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    WEE1; WEE1 G2 Checkpoint Kinase; Wee1-Like Protein Kinase; WEE1A; Wee1A Kinase; WEE1hu; Non-Specific Protein-Tyrosine Kinase; Wee1+ (S. Pombe) Homolog; WEE1 Homolog (S. Pombe); Protein Kinase; WEE1+ Homolog; WEE1 Homolog

  • AA Sequence

    MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK

  • Predicted Molecular Mass

    34.2 kDa

  • Molecular Weight

    Approximately 34 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 200 mM NaCl, 20% glycerol, 1 mM DTT, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00