Wee1 Protein, Human (Active, sf9)
Wee1 Protein acts as a crucial negative regulator of the G2 to M transition, ensuring nuclear protection by phosphorylating CDK1 on 'Tyr-15' and inactivating the cyclin B1-CDK1 complex. Its peak activity in G2 phase decreases as cells progress into M phase, with dynamic regulation, increased phosphorylation during S and G2 phases, and diminished levels during M/G1 phase transition potentially due to degradation. Wee1 Protein, Human (sf9) is the recombinant human-derived Wee1 protein, expressed by sf9 insect cells , with tag free.
- Species: Human
- Source: Sf9 insect cells
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Wee1 Protein acts as a crucial negative regulator of the G2 to M transition, ensuring nuclear protection by phosphorylating CDK1 on 'Tyr-15' and inactivating the cyclin B1-CDK1 complex. Its peak activity in G2 phase decreases as cells progress into M phase, with dynamic regulation, increased phosphorylation during S and G2 phases, and diminished levels during M/G1 phase transition potentially due to degradation. Wee1 Protein, Human (sf9) is the recombinant human-derived Wee1 protein, expressed by sf9 insect cells , with tag free.
Wee1 Protein functions as a critical negative regulator of the G2 to M transition, preventing entry into mitosis by safeguarding the nucleus from the activation of cytoplasmically bound cyclin B1-complexed CDK1. Through the phosphorylation of CDK1 on 'Tyr-15,' Wee1 specifically targets and inactivates the cyclin B1-CDK1 complex, with its activity peaking during the G2 phase and reaching a minimum as cells progress into M phase. Notably, Wee1's phosphorylation of cyclin B1-CDK1 occurs exclusively on 'Tyr-15,' while monomeric CDK1 remains unphosphorylated. Its activity undergoes dynamic regulation, increasing during S and G2 phases and diminishing at M phase, accompanied by hyperphosphorylation. Additionally, a correlated reduction in Wee1 protein levels occurs during the M/G1 phase transition, potentially attributed to its degradation.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
P30291-1 (M291-K575)
-
Gene ID7465
-
Molecular Construction
-
N-term
-
Wee1 (M291-K575)
Accession # P30291-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
WEE1; WEE1 G2 Checkpoint Kinase; Wee1‑Like Protein Kinase; WEE1A; Wee1A Kinase; WEE1hu; Non‑Specific Protein‑Tyrosine Kinase; Wee1+ (S. Pombe) Homolog; WEE1 Homolog (S. Pombe); Protein Kinase; WEE1+ Homolog; WEE1 Homolog
-
AA Sequence
MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
