YY1 Protein, Human (His)
Based on 2 publication(s) in Google Scholar
The multifunctional transcription factor YY1 controls a variety of cellular and viral genes by binding to sites that overlap with the transcription start site. YY1 recognizes the consensus sequence 5'-CCGCCATNTT-3' and exhibits context-dependent transcriptional regulation, with methylation of the initial CG dinucleotide affecting binding affinity. YY1 Protein, Human (His) is the recombinant human-derived YY1 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The multifunctional transcription factor YY1 controls a variety of cellular and viral genes by binding to sites that overlap with the transcription start site. YY1 recognizes the consensus sequence 5'-CCGCCATNTT-3' and exhibits context-dependent transcriptional regulation, with methylation of the initial CG dinucleotide affecting binding affinity. YY1 Protein, Human (His) is the recombinant human-derived YY1 protein, expressed by E. coli , with C-6*His labeled tag.
Background
YY1, a multifunctional transcription factor, exerts both positive and negative control over a plethora of cellular and viral genes by binding to sites overlapping the transcription start site. Recognizing the consensus sequence 5'-CCGCCATNTT-3', YY1 may engage in enhanced binding with some genes that harbor a longer motif, with methylation of the initial CG dinucleotide markedly reducing binding affinity. The impact on transcriptional regulation varies based on the context in which YY1 binds, featuring diverse mechanisms such as direct activation or repression, indirect modulation through cofactor recruitment, and activation or repression via the disruption of binding sites or conformational DNA changes. YY1's activity is intricately regulated by transcription factors and cytoplasmic proteins, which can either abrogate or completely inhibit its mediated activation or repression. Notably, it acts as a repressor in the absence of adenovirus E1A protein but transforms into an activator in its presence. Collaborating with SMAD1 and SMAD4, YY1 participates in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression by binding to SMAD binding elements within BMP response elements. YY1 is implicated in development, differentiation, and proposed to recruit the PRC2/EED-EZH2 complex to target genes undergoing transcriptional repression. Furthermore, YY1 plays a role in DNA repair, exhibiting a propensity to bind to DNA recombination intermediate structures, and contributes to the regulation of enhancer activation. It is proposed as a core component of the chromatin remodeling INO80 complex, targeting this complex to YY1-responsive elements involved in transcriptional regulation, DNA replication, and potentially DNA repair.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Phytomedicine
The anti-non-small cell lung cancer effect of Diosbulbin B: Targeting YY1 induced cell cycle arrest and apoptosis. [Abstract]2024 Jul 25:130:155734. PMID: 38761775 -
Biochem Biophys Res Commun
2026 Jan 8:795:153117. PMID: 41380445
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P25490 (V221-G321)
-
Molecular Construction
-
N-term
-
YY1 (V221-G321)
Accession # P25490 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
YY1; YY1 Transcription Factor; INO80S; NF-E1; INO80 Complex Subunit S; YIN-YANG-1; DELTA; UCRBP; Transcriptional Repressor Protein YY1; Delta Transcription Factor; Yin And Yang 1 Protein; YY-1; Yin And Yang 1; GADEVS
-
AA Sequence
VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHG
-
Predicted Molecular Mass
12.6 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)