ZFAND5 Protein, Human (sf9, His, StrepⅡ)
The ZFAND5 protein is a key player in protein degradation by the ubiquitin-proteasome system and serves as a potential anchor for ubiquitinated proteins, promoting their proteasomal targeting. It regulates NF-kappa-B activation and apoptosis by inhibiting NF-kappa-B activation induced by various stimuli, including RIPK1 and TRAF6 overexpression. ZFAND5 Protein, Human (sf9, His, Strep) is the recombinant human-derived ZFAND5 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The ZFAND5 protein is a key player in protein degradation by the ubiquitin-proteasome system and serves as a potential anchor for ubiquitinated proteins, promoting their proteasomal targeting. It regulates NF-kappa-B activation and apoptosis by inhibiting NF-kappa-B activation induced by various stimuli, including RIPK1 and TRAF6 overexpression. ZFAND5 Protein, Human (sf9, His, Strep) is the recombinant human-derived ZFAND5 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
Background
ZFAND5 protein participates in the intricate processes of protein degradation via the ubiquitin-proteasome system, potentially serving as an anchor for ubiquitinated proteins to facilitate their targeting to the proteasome. Its involvement extends to the regulation of NF-kappa-B activation and apoptosis, exerting inhibitory effects on NF-kappa-B activation induced by various stimuli, including overexpression of RIPK1 and TRAF6, while not affecting RELA-triggered activation. ZFAND5 demonstrates a dose-dependent inhibition of NF-kappa-B activation in response to TNF, IL-1, and TLR4 stimuli and sensitizes cells to TNF-induced apoptosis. Notably, it acts as a potent inhibitory factor in osteoclast differentiation. Functionally, ZFAND5 interacts with ubiquitin and polyubiquitinated proteins and forms a heterotrimeric complex with ubiquitin and SQSTM1, with both ZFAND5 and SQSTM1 binding to the same ubiquitin molecule, emphasizing its role in coordinating ubiquitin-mediated processes. Additionally, ZFAND5 engages in interactions with IKBKG, RIPK1, and TRAF6 through specific domains, further underscoring its involvement in crucial cellular pathways.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-StrepⅡ;N-8*His
-
Accession
O76080 (A2-I213)
-
Gene ID7763
-
Molecular Construction
-
N-term
-
8*His-StrepⅡ
-
ZFAND5 (A2-I213)
Accession # O76080 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ZFAND5; Zinc Finger AN1-Type Containing 5; ZA20D2; ZNF216; Zinc Finger Protein 216; ZFAND5A; Zinc Finger A20 Domain-Containing Protein 2; Zinc Finger, A20 Domain Containing 2; Zinc Finger, AN1-Type Domain 5; AN1-Type Zinc Finger Protein 5
-
AA Sequence
AQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)