ZFAND5 Protein, Human (sf9, His, StrepⅡ)

The ZFAND5 protein is a key player in protein degradation by the ubiquitin-proteasome system and serves as a potential anchor for ubiquitinated proteins, promoting their proteasomal targeting. It regulates NF-kappa-B activation and apoptosis by inhibiting NF-kappa-B activation induced by various stimuli, including RIPK1 and TRAF6 overexpression. ZFAND5 Protein, Human (sf9, His, Strep) is the recombinant human-derived ZFAND5 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The ZFAND5 protein is a key player in protein degradation by the ubiquitin-proteasome system and serves as a potential anchor for ubiquitinated proteins, promoting their proteasomal targeting. It regulates NF-kappa-B activation and apoptosis by inhibiting NF-kappa-B activation induced by various stimuli, including RIPK1 and TRAF6 overexpression. ZFAND5 Protein, Human (sf9, His, Strep) is the recombinant human-derived ZFAND5 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

Background

ZFAND5 protein participates in the intricate processes of protein degradation via the ubiquitin-proteasome system, potentially serving as an anchor for ubiquitinated proteins to facilitate their targeting to the proteasome. Its involvement extends to the regulation of NF-kappa-B activation and apoptosis, exerting inhibitory effects on NF-kappa-B activation induced by various stimuli, including overexpression of RIPK1 and TRAF6, while not affecting RELA-triggered activation. ZFAND5 demonstrates a dose-dependent inhibition of NF-kappa-B activation in response to TNF, IL-1, and TLR4 stimuli and sensitizes cells to TNF-induced apoptosis. Notably, it acts as a potent inhibitory factor in osteoclast differentiation. Functionally, ZFAND5 interacts with ubiquitin and polyubiquitinated proteins and forms a heterotrimeric complex with ubiquitin and SQSTM1, with both ZFAND5 and SQSTM1 binding to the same ubiquitin molecule, emphasizing its role in coordinating ubiquitin-mediated processes. Additionally, ZFAND5 engages in interactions with IKBKG, RIPK1, and TRAF6 through specific domains, further underscoring its involvement in crucial cellular pathways.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-StrepⅡ;N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His-StrepⅡ
    • ZFAND5 (A2-I213)
      Accession # O76080
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    ZFAND5; Zinc Finger AN1-Type Containing 5; ZA20D2; ZNF216; Zinc Finger Protein 216; ZFAND5A; Zinc Finger A20 Domain-Containing Protein 2; Zinc Finger, A20 Domain Containing 2; Zinc Finger, AN1-Type Domain 5; AN1-Type Zinc Finger Protein 5

  • AA Sequence

    AQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00