1. Recombinant Proteins
  2. Others
  3. ZFAND5 Protein, Human (sf9, His, StrepⅡ)

The ZFAND5 protein is a key player in protein degradation by the ubiquitin-proteasome system and serves as a potential anchor for ubiquitinated proteins, promoting their proteasomal targeting. It regulates NF-kappa-B activation and apoptosis by inhibiting NF-kappa-B activation induced by various stimuli, including RIPK1 and TRAF6 overexpression. ZFAND5 Protein, Human (sf9, His, Strep) is the recombinant human-derived ZFAND5 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ZFAND5 protein is a key player in protein degradation by the ubiquitin-proteasome system and serves as a potential anchor for ubiquitinated proteins, promoting their proteasomal targeting. It regulates NF-kappa-B activation and apoptosis by inhibiting NF-kappa-B activation induced by various stimuli, including RIPK1 and TRAF6 overexpression. ZFAND5 Protein, Human (sf9, His, Strep) is the recombinant human-derived ZFAND5 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

Background

ZFAND5 protein participates in the intricate processes of protein degradation via the ubiquitin-proteasome system, potentially serving as an anchor for ubiquitinated proteins to facilitate their targeting to the proteasome. Its involvement extends to the regulation of NF-kappa-B activation and apoptosis, exerting inhibitory effects on NF-kappa-B activation induced by various stimuli, including overexpression of RIPK1 and TRAF6, while not affecting RELA-triggered activation. ZFAND5 demonstrates a dose-dependent inhibition of NF-kappa-B activation in response to TNF, IL-1, and TLR4 stimuli and sensitizes cells to TNF-induced apoptosis. Notably, it acts as a potent inhibitory factor in osteoclast differentiation. Functionally, ZFAND5 interacts with ubiquitin and polyubiquitinated proteins and forms a heterotrimeric complex with ubiquitin and SQSTM1, with both ZFAND5 and SQSTM1 binding to the same ubiquitin molecule, emphasizing its role in coordinating ubiquitin-mediated processes. Additionally, ZFAND5 engages in interactions with IKBKG, RIPK1, and TRAF6 through specific domains, further underscoring its involvement in crucial cellular pathways.

Species

Human

Source

Sf9 insect cells

Tag

N-StrepⅡ;N-8*His

Accession

O76080 (A2-I213)

Gene ID

7763

Molecular Construction
N-term
8*His-StrepⅡ
ZFAND5 (A2-I213)
Accession # O76080
C-term
Protein Length

Full Length

Synonyms
ZFAND5; AN1-type zinc finger protein 5; Zinc finger A20 domain-containing protein 2; Zinc finger protein 216
AA Sequence

AQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ZFAND5 Protein, Human (sf9, His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ZFAND5 Protein, Human (sf9, His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ZFAND5 Protein, Human (sf9, His, StrepⅡ)
Cat. No.:
HY-P701604
Quantity:
MCE Japan Authorized Agent: