1. Peptides
  2. β-Amyloid (1-40), FAM-labeled

β-Amyloid (1-40), FAM-labeled 

Cat. No.: HY-P2550
Handling Instructions

β-Amyloid (1-40), FAM-labeled is a FAM fluorescently-labelled β-Amyloid (1-40) peptide (λex= 492 nm and λem= 518 nm).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Amyloid (1-40), FAM-labeled Chemical Structure

β-Amyloid (1-40), FAM-labeled Chemical Structure

CAS No. : 1678416-08-4

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Amyloid (1-40), FAM-labeled is a FAM fluorescently-labelled β-Amyloid (1-40) peptide (λex= 492 nm and λem= 518 nm)[1].

IC50 & Target

λex= 492 nm; λem= 518 nm

In Vitro

Apical-to-basolateral exchange across endothelial monolayer of fluorescent Aβ42 (FAM-labeled Human β-Amyloid (1-42) and Fluor488-labeled β-Amyloid (1-42)) or scramble Aβ42 (FAM-labeled scrambled β-Amyloid (1-42)) (1-100 μM) is monitored in transendothelial electrical resistance (TEER) during cell monolayer’s formation over time (over 120 min in presence or absence of Aβ24). Human β-Amyloid (1-24) (1 μM) results in H-Aβ42 retention, thus reducing its efflux through the BBB and therefore preventing an efficient mechanism of Aβ42 clearance[1].
The in vitro BBB model is used to investigate the passage of FAM-labeled or 488-conjugated H-Aβ42 across the endothelial cell monolayer. The addition of fluorescently labeled H-Aβ42 (FAM-labeled Human β-Amyloid (1-42) or Fluor 488-labeled β-Amyloid (1-42)) to the apical side of cell inserts results in effective BBB crossing, FAM-labeled scrambled β-Amyloid (1-42) is not efficiently transcytosed.

Molecular Weight

4688.20

Formula

C₂₁₅H₃₀₅N₅₃O₆₄S

CAS No.

1678416-08-4

Sequence Shortening

FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

β-Amyloid (1-40), FAM-labeledOthersβ-AmyloidFAM-labeledfluorescentlyInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Amyloid (1-40), FAM-labeled
Cat. No.:
HY-P2550
Quantity:
MCE Japan Authorized Agent: