β-Amyloid (1-40), FAM-labeled TFA
Based on 1 Customer Validation
β-Amyloid (1-40), FAM-labeled TFA is a FAM fluorescently-labelled β-Amyloid (1-40) peptide (λex= 492 nm and λem= 518 nm).
For research use only. We do not sell to patients.
- Purity : 99.87%
- Formula: C217H306N53F3O66S
- Molecular Weight:4802.22
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Biological Activity
Description
In Vitro
Apical-to-basolateral exchange across endothelial monolayer of fluorescent Aβ42 (FAM-labeled Human β-Amyloid (1-42) and Fluor 488-labeled β-Amyloid (1-42)) or scramble Aβ42 (FAM-labeled scrambled β-Amyloid (1-42)) (1-100 μM) is monitored in transendothelial electrical resistance (TEER) during cell monolayer’s formation over time (over 120 min in presence or absence of Aβ24). Human β-Amyloid (1-24) (1 μM) results in H-Aβ42 retention, thus reducing its efflux through the BBB and therefore preventing an efficient mechanism of Aβ42 clearance[1].The in vitro BBB model is used to investigate the passage of FAM-labeled or 488-conjugated H-Aβ42 across the endothelial cell monolayer. The addition of fluorescently labeled H-Aβ42 (FAM-labeled Human β-Amyloid (1-42) or Fluor 488-labeled β-Amyloid (1-42)) to the apical side of cell inserts results in effective BBB crossing, FAM-labeled scrambled β-Amyloid (1-42) is not efficiently transcytosed.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4802.22
-
Formula C217H306N53F3O66S
-
Color Light yellow to yellow
-
Sequence
FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
-
Sequence Shortening
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Solvent & Solubility
In Vitro:
DMSO : 10 mg/mL (2.08 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Protocols
-
Amyloid: Congo Red Amyloid Staining
Congo red amyloid staining is a histochemical method used to detect extracellular amyloid deposits in tissue sections based on the affinity of Congo red dye for β-pleated sheet-rich protein aggregates. When bound to amyloid, Congo red produces characteristic apple-green birefringence under polarized light microscopy, which is widely regarded as a diagnostic feature of amyloid deposition in histopathology. The diagnostic principle relies on the combination of dye binding (congophilia) and optical anisotropy under polarized illumination, which distinguishes amyloid from most non-amyloid eosinophilic extracellular deposits in routine histological evaluation. Amyloid identification by Congo red staining remains a cornerstone in diagnostic pathology despite the availability of adjunct methods such as immunohistochemistry and mass spectrometry, particularly because of its ability to localize deposits directly within tissue architecture. The specificity of Congo red-positive deposits is incre
Purity & Documentation
-
Data Sheet (288 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. L M Jungbauer, et al. Preparation of fluorescently-labeled amyloid-beta peptide assemblies: the effect of fluorophore conjugation on structure and function. J Mol Recognit. Sep-Oct 2009;22(5):403-13. [Content Brief]
[2]. Sonia Mazzitelli, et al. Amyloid-β 1-24 C-terminal truncated fragment promotes amyloid-β 1-42 aggregate formation in the healthy brain. Acta Neuropathol Commun. 2016 Oct 10;4(1):110. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2082 mL | 1.0412 mL | 2.0824 mL | 5.2059 mL |