Calcitonin, porcine
Calcitonin, porcine inhibits 1,25 (OH)2D3-stimulated porcine osteoclast differentiation. Calcitonin is a polypeptide hormone that can lower serum calcium by decreasing calcium reabsorption in the kidney and inhibiting osteoclastic bone resorption. Calcitonin, porcine can be used for research of hypercalcemia.
For research use only. We do not sell to patients.
- CAS No.: 12321-44-7
- Formula: C159H232N46O45S3
- Molecular Weight:3604.02
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Chemical Information
-
CAS No. 12321-44-7
-
Molecular Weight 3604.02
-
Formula C159H232N46O45S3
-
Sequence
Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Ser-Ala-Tyr-Trp-Arg-Asn-Leu-Asn-Asn-Phe-His-Arg-Phe-Ser-Gly-Met-Gly-Phe-Gly-Pro-Glu-Thr-Pro-NH2 (Disulfidebridge:Cys1-Cys7)
-
Sequence Shortening
CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP-NH2 (Disulfidebridge:Cys1-Cys7)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Galvin RJ, et al. Calcitonin responsiveness and receptor expression in porcine and murine osteoclasts: a comparative study. Bone. 1998 Sep;23(3):233-40. [Content Brief]
[2]. Kammerman S, et al. Effect of porcine calcitonin on hypercalcemia in man. J Clin Endocrinol Metab. 1970 Jul;31(1):70-5. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Calcitonin, porcine Related Classifications
HY-P10299 Related Classifications
Powered by Bioz