88813-36-9
Chemical Structure
Galanin (swine)
- CAS No.: 88813-36-9
- Formula:C146H213N43O40
- Molecular Weight:3210.52
SMILES: [GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2]
Biological Activity: Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively[1].
| Cat. No. | Product Name | Purity | Description | Pricing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
Galanin (swine) | 98.20% | Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively. | ||||||||||||||||||||
|
loading...
/
|
|||||||||||||||||||||||