VIPhyb
Based on 1 Customer Validation
VIPhyb is a vasoactive intestinal polypeptide (VIP) receptor antagonist. VIPhyb can inhibit VIP signaling, increase T-cell immunity and downregulate PD1. VIPhyb can inhibit cancer cell proliferation. VIPhyb can reduce inflammatory cytokine expression. VIPhyb can enhance viral clearance. VIPhyb can be used for the researches of cancer, infection and inflammation and immunology, such as non-small cell lung cancer (NSCLC), cytomegalovirus infection and colitis.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 99.82%
- CAS. Nr.: 125093-93-8
- Formel: C154H257N49O40S
- Molecular Weight:3467.06
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biologische Aktivität
Beschreibung
In Vitro
VIPhyb shows an IC50 of 500 nM against NCI-H1299 cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
VIPhyb (0.1-1 μM, i.p., daily for 11 days) reduces inflammation in dextran sodium sulfate (DSS) (HY-116282C)-induced colitis mice models[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Murine cytomegalovirus (mCMV) -infected C57BL/6 and BALB/c mice[2]
-
Dosage:10 μg/mouse
-
Administration:Subcutaneously injection, daily for 1 week starting the day prior to infection
-
Result:Prolonged survival of mice.
Had less inflammation and tissue damage in the liver.
Decreased intranuclear viral inclusions, inflammatory leukocytes, necrosis, and CMV-infected giant cells.
Increased the numbers of effector/memory CD8+ T-cells and mature NK cells were.
Prevented the up-regulation of PD-L1.
Increased CD80, CD86, and MHC-II expression.
Increased numbers of IFN-γ- and TNF-α-expressing NK cells and T-cells.
Decreased the percentage of Treg cells and levels of serum VEGF.
-
Animal Model:Dextran sodium sulfate (DSS)-induced colitis mice models[3]
-
Dosage:0.1 and 1 μM
-
Administration:Intraperitoneally injection, daily for 11 days
-
Result:Led to a significant reduction of weight loss percentage and bloody diarrhea.
Reduced colonic weight/length ratio.
Decreased expression of IL-1, TNF-α, and IL-6.
Chemical Information
-
CAS. Nr. 125093-93-8
-
Appearance Solid
-
Molecular Weight 3467.06
-
Formel C154H257N49O40S
-
Color White to off-white
-
Sequence
Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
-
Sequence Shortening
KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Lösungsmittel & Löslichkeit
In Vitro:
DMSO : 100 mg/mL (28.84 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : ≥ 100 mg/mL (28.84 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Reinheit & Dokumentation
-
Data Sheet (283 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Moody TW, et al. (Stearyl, Norleucine17)VIP hybrid antagonizes VIP receptors on non-small cell lung cancer cells. Life Sci. 1997;61(17):1657-66. [Content Brief]
[2]. Li JM, et al. VIPhyb, an antagonist of vasoactive intestinal peptide receptor, enhances cellular antiviral immunity in murine cytomegalovirus infected mice. PLoS One. 2013 May 27;8(5):e63381. [Content Brief]
[3]. Vu JP, et al. Inhibition of vasoactive intestinal polypeptide (VIP) induces resistance to dextran sodium sulfate (DSS)-induced colitis in mice. J Mol Neurosci. 2014 Jan;52(1):37-47. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO / H2O | 1 mM | 0.2884 mL | 1.4421 mL | 2.8843 mL | 7.2107 mL |
| 5 mM | 0.0577 mL | 0.2884 mL | 0.5769 mL | 1.4421 mL | |
| 10 mM | 0.0288 mL | 0.1442 mL | 0.2884 mL | 0.7211 mL | |
| 15 mM | 0.0192 mL | 0.0961 mL | 0.1923 mL | 0.4807 mL | |
| 20 mM | 0.0144 mL | 0.0721 mL | 0.1442 mL | 0.3605 mL | |
| 25 mM | 0.0115 mL | 0.0577 mL | 0.1154 mL | 0.2884 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.