Teduglutide TFA
Based on 2 publication(s) in Google Scholar
Teduglutide TFA is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide TFA can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 and intestinal FXR signaling in human hepatic stellate cells, thereby improving liver inflammation and fibrosis in mice with sclerosing cholangitis. Teduglutide TFA can alleviate intestinal dysfunction in mice, improve lung injury, alleviate obesity related neuroinflammation and cell apoptosis.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C164H252N44O55S.xC2HF3O2
- Masse moléculaire:3752.13 (free acid)
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications Citing Use of MedChemExpress (MCE) Teduglutide TFA
MoreVoir tous les produits spécifiques à Isoform Nuclear Hormone Receptor 4A/NR4A
More
Activité biologique
Teduglutide (2.5 μM, 36 h) TFA can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 in human hepatic stellate cells[4]. Teduglutide TFA can increase the proliferation of all intestinal segment epithelial cells and reduce cell apoptosis in the short intestine newborn piglet model[5].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:Human Hepatic Stellate Cells (HSC)
-
Concentration:2.5 μM
-
Incubation Time:36 h
-
Result:Increased transcription levels of NR4a1/Nur77.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Adult male mice undergoing 12-cm ileocecal and cecal resection (ICR)[1].
-
Dosage:0.1 mg/kg
-
Administration:Subcutaneous injection (s.c.); twice daily; 2 weeks
-
Result:Resulted in a decrease in plasma aldosterone concentration, a decrease in fecal water content, and a decrease in fecal sodium loss.
-
Animal Model:A mouse model with lung injury induced by tumor necrosis factor-alpha (TNF-α) and actinomycin D (Act D)[2].
-
Dosage:200 μg/kg
-
Administration:Subcutaneous injection (s.c.); twice daily; 10 days
-
Result:Attenuated structural damage, cell apoptosis, and oxidative stress by reducing lipid peroxidation in mice receiving TNF - α/AtD.
-
Animal Model:Mice fed a high-fat diet (HFD)[3].
-
Dosage:5 μg
-
Administration:Intraperitoneal injection (i.p.); once daily; 4 weeks
-
Result:Reduced the expression of HFD induced pro-inflammatory mediators (NF kB, IL-8, TNF - α, IL-1 β, and IL-6), glial fibrillary acidic protein (GFAP), glial proliferation and neurodegeneration index, stress marker proteins (p-ERK, Hsp60, and i-NOS), and amyloid beta precursor protein (APP).
-
Animal Model:The Mdr2/Abcb4 mouse model of sclerosing cholangitis displaying hepatic inflammation and fibrosis[4].
-
Dosage:0.05 mg/kg
-
Administration:Intraperitoneal injection (i.p.); once daily; 4 weeks
-
Result:Resulted in an increase in intrahepatic level of muricholic acids and serum Fgf15 level, as well as a decrease in mRNA levels of Cyp7a1 and FXR.
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
Masse moléculaire 3752.13 (free acid)
-
Formule C164H252N44O55S.xC2HF3O2
-
Synonyms
ALX-0600 TFA
-
Sequence
His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
-
Sequence Shortening
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Nat Metab
2025 Apr;7(4):730-741. PMID: 40114026 -
Arch Gerontol Geriatr
GLP-2 ameliorates D-galactose induced muscle aging by IGF-1/Pi3k/Akt/FoxO3a signaling pathway in C2C12 cells and mice. [Abstract]2024 Sep:124:105462. PMID: 38692155
Pureté et documentation
Références
[1]. Reiner J, et al. Teduglutide Promotes Epithelial Tight Junction Pore Function in Murine Short Bowel Syndrome to Alleviate Intestinal Insufficiency. Dig Dis Sci. 2020 Dec;65(12):3521-3537. [Content Brief]
[2]. Arda-Pirincci P, et al. Teduglutide, a glucagon-like peptide 2 analogue: a novel protective agent with anti-apoptotic and anti-oxidant properties in mice with lung injury. Peptides. 2012 Dec;38(2):238-47. [Content Brief]
[3]. Nuzzo D, et al. Glucagon-like peptide-2 reduces the obesity-associated inflammation in the brain. Neurobiol Dis. 2019 Jan;121:296-304. [Content Brief]
[4]. Fuchs CD, et al. GLP-2 Improves Hepatic Inflammation and Fibrosis in Mdr2-/- Mice Via Activation of NR4a1/Nur77 in Hepatic Stellate Cells and Intestinal FXR Signaling. Cell Mol Gastroenterol Hepatol. 2023;16(5):847-856. [Content Brief]
[5]. Naberhuis JK, et al. Teduglutide-Stimulated Intestinal Adaptation Is Complemented and Synergistically Enhanced by Partial Enteral Nutrition in a Neonatal Piglet Model of Short Bowel Syndrome. JPEN J Parenter Enteral Nutr. 2017 Jul;41(5):853-865. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)