1. Neuronal Signaling
  2. Amyloid-β
  3. Citrullinated amyloid-β (1-42) peptide (human)

Citrullinated amyloid-β (1-42) peptide (human)  (Synonyms: Citrullinated Aβ (1-42); Citrullinated Aβ42)

Cat. No.: HY-P5905
Handling Instructions Technical Support

Citrullinated amyloid-β (1-42) peptide (human) (Citrullinated Aβ (1-42)) is a modified form of β-Amyloid (1-42) (HY-P1363) with a citrullination at the Arg5 site. Compared to the unmodified β-Amyloid (1-42), its formation of soluble low-molecular-weight oligomers is enhanced, the rate of fibril formation is reduced, and like unmodified Aβ42, it forms protofibrils comprised of parallel β-sheets.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Citrullinated amyloid-β (1-42) peptide (human)

Citrullinated amyloid-β (1-42) peptide (human) Chemical Structure

Size Price Stock Quantity
1 mg Get quote 2 - 3 weeks 1 - 2 Weeks 3 - 4 weeks 2 - 3 weeks
5 mg   Get quote  
10 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Citrullinated amyloid-β (1-42) peptide (human)

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Citrullinated amyloid-β (1-42) peptide (human) (Citrullinated Aβ (1-42)) is a modified form of β-Amyloid (1-42) (HY-P1363) with a citrullination at the Arg5 site. Compared to the unmodified β-Amyloid (1-42), its formation of soluble low-molecular-weight oligomers is enhanced, the rate of fibril formation is reduced, and like unmodified Aβ42, it forms protofibrils comprised of parallel β-sheets[1].

Molecular Weight

4515.02

Formula

C203H310N54O61S

Appearance

Solid

Color

White to off-white

Sequence

Asp-Ala-Glu-Phe-{Cit}-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Sequence Shortening

DAEF-{Cit}-HDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Citrullinated amyloid-β (1-42) peptide (human)
Cat. No.:
HY-P5905
Quantity:
MCE Japan Authorized Agent: